SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brS-1001
         (698 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U52077-1|AAC52010.1|  343|Homo sapiens mariner transposase protein.    36   0.14 

>U52077-1|AAC52010.1|  343|Homo sapiens mariner transposase protein.
          Length = 343

 Score = 35.9 bits (79), Expect = 0.14
 Identities = 19/72 (26%), Positives = 33/72 (45%)
 Frame = -3

Query: 642 PSSSPDLNPLDYDI*SVLESTACSKRHDNLESLKQSVRLAVTNFPMERVRASIDNWPQRL 463
           P  SPDL+P DY     L++    KR  N +  + + +  V +   +     I+    R 
Sbjct: 272 PPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDAENAFQEFVESRSTDFYATGINKLISRW 331

Query: 462 KDCIAANGDHFE 427
           + C+  NG +F+
Sbjct: 332 QKCVDCNGSYFD 343


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 90,169,680
Number of Sequences: 237096
Number of extensions: 1710955
Number of successful extensions: 2268
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2216
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2268
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8063224416
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -