BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1001 (698 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U52077-1|AAC52010.1| 343|Homo sapiens mariner transposase protein. 36 0.14 >U52077-1|AAC52010.1| 343|Homo sapiens mariner transposase protein. Length = 343 Score = 35.9 bits (79), Expect = 0.14 Identities = 19/72 (26%), Positives = 33/72 (45%) Frame = -3 Query: 642 PSSSPDLNPLDYDI*SVLESTACSKRHDNLESLKQSVRLAVTNFPMERVRASIDNWPQRL 463 P SPDL+P DY L++ KR N + + + + V + + I+ R Sbjct: 272 PPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDAENAFQEFVESRSTDFYATGINKLISRW 331 Query: 462 KDCIAANGDHFE 427 + C+ NG +F+ Sbjct: 332 QKCVDCNGSYFD 343 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,169,680 Number of Sequences: 237096 Number of extensions: 1710955 Number of successful extensions: 2268 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2216 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2268 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8063224416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -