BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= brS-1001
(698 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
U52077-1|AAC52010.1| 343|Homo sapiens mariner transposase protein. 36 0.14
>U52077-1|AAC52010.1| 343|Homo sapiens mariner transposase protein.
Length = 343
Score = 35.9 bits (79), Expect = 0.14
Identities = 19/72 (26%), Positives = 33/72 (45%)
Frame = -3
Query: 642 PSSSPDLNPLDYDI*SVLESTACSKRHDNLESLKQSVRLAVTNFPMERVRASIDNWPQRL 463
P SPDL+P DY L++ KR N + + + + V + + I+ R
Sbjct: 272 PPYSPDLSPTDYHFFKHLDNFLQGKRFHNQQDAENAFQEFVESRSTDFYATGINKLISRW 331
Query: 462 KDCIAANGDHFE 427
+ C+ NG +F+
Sbjct: 332 QKCVDCNGSYFD 343
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 90,169,680
Number of Sequences: 237096
Number of extensions: 1710955
Number of successful extensions: 2268
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2216
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2268
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8063224416
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -