BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1000 (496 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9857| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 3e-05 SB_35108| Best HMM Match : AT_hook (HMM E-Value=0.15) 31 0.52 SB_26086| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_25483| Best HMM Match : zf-B_box (HMM E-Value=0.21) 29 2.8 SB_20883| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_47465| Best HMM Match : EGF_CA (HMM E-Value=2.4e-08) 27 6.4 SB_11325| Best HMM Match : Gurmarin (HMM E-Value=3.3) 27 6.4 SB_54678| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_13598| Best HMM Match : Gurmarin (HMM E-Value=3.3) 27 6.4 SB_13044| Best HMM Match : Vps26 (HMM E-Value=0) 27 8.5 SB_51925| Best HMM Match : DIX (HMM E-Value=0.75) 27 8.5 >SB_9857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1125 Score = 45.2 bits (102), Expect = 3e-05 Identities = 34/89 (38%), Positives = 49/89 (55%), Gaps = 4/89 (4%) Frame = +1 Query: 184 RKKKMACATLKRNLDWE---SKAQLPT-KRRRCSPFAASPSTSPGLKTSESKPSSFGESV 351 R KMACATLKR+ +++ S P+ KRRRC P A S S S +S + S F E Sbjct: 151 RFSKMACATLKRSYEFDPLLSPQHQPSPKRRRCIPMATSSSPS----SSSNTDSPFLEIT 206 Query: 352 SAPVKITPERMAQEIYDEIKRLHRRGQLR 438 + + E+++ ++ E KRL RR L+ Sbjct: 207 P---RYSQEQLSTNLHMEWKRLQRRKHLK 232 >SB_35108| Best HMM Match : AT_hook (HMM E-Value=0.15) Length = 1600 Score = 31.1 bits (67), Expect = 0.52 Identities = 21/88 (23%), Positives = 37/88 (42%) Frame = +1 Query: 142 QIR*HIRKPEDFVGRKKKMACATLKRNLDWESKAQLPTKRRRCSPFAASPSTSPGLKTSE 321 Q R KP+D RK K++C T K K + + + A+S + ++S+ Sbjct: 979 QARPRPSKPQDQASRKTKVSCMTKKDQYQASRKTKQVARPSKPQDQASSKTQD---QSSD 1035 Query: 322 SKPSSFGESVSAPVKITPERMAQEIYDE 405 + + + P+KI P + Q E Sbjct: 1036 GREGGYSRYLMLPLKIIPAVIIQRALPE 1063 >SB_26086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1511 Score = 28.7 bits (61), Expect = 2.8 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 4/76 (5%) Frame = -3 Query: 353 LTDSPNEDGFDSDVFNP----GLVLGLAANGEHLLLFVGNCALDSQSRFLFNVAHAIFFL 186 + +S + DG+DSD F+ LG N + L V D++S+ L+N+AH I Sbjct: 498 VANSDDSDGWDSDEFDDEDDDNATLGEDRNKKQELDLVFP---DARSKKLYNIAHEILTT 554 Query: 185 RPTKSSGLRICQRICF 138 LR+ ++ F Sbjct: 555 ERAYVKRLRLLDKVFF 570 >SB_25483| Best HMM Match : zf-B_box (HMM E-Value=0.21) Length = 258 Score = 28.7 bits (61), Expect = 2.8 Identities = 18/66 (27%), Positives = 30/66 (45%) Frame = +1 Query: 181 GRKKKMACATLKRNLDWESKAQLPTKRRRCSPFAASPSTSPGLKTSESKPSSFGESVSAP 360 G++KK LK D + ++ +KR+R P ST P +K + G+ S Sbjct: 7 GKRKKSVEELLKEGRDLLDRQEVKSKRKR-KPVRFLFSTDPATGLRNNKGTYKGQKKSKE 65 Query: 361 VKITPE 378 ++ PE Sbjct: 66 KRLNPE 71 >SB_20883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 672 Score = 27.9 bits (59), Expect = 4.9 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +1 Query: 310 KTSESKPSSFGESVSAPVKITPERMAQEIYDEIKR 414 +T ESK S S+S PVK+ E+ +Y+ +K+ Sbjct: 335 ETKESKISRSPISISVPVKVGDEKTKGYVYNVLKK 369 >SB_47465| Best HMM Match : EGF_CA (HMM E-Value=2.4e-08) Length = 263 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +2 Query: 389 KRFMMRLNDCIDVDSCAWPTALLHHA 466 K F+ C+D+D C +P HA Sbjct: 142 KGFVREPEGCVDIDECVYPRVCSEHA 167 >SB_11325| Best HMM Match : Gurmarin (HMM E-Value=3.3) Length = 194 Score = 27.5 bits (58), Expect = 6.4 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 1/66 (1%) Frame = -3 Query: 209 VAHAIFFLRPTKSSGLRICQRICFNYEYKKMKNNIKPHTGNTRKKYTIRFQV-TVKSDVL 33 V H L SGL +C I + K+ +K T N + ++ + +V KSDVL Sbjct: 128 VTHQAMLLLKVMVSGLVVCPIIEISANQKRAWIALKQKTANHLEGFSKKLEVLNPKSDVL 187 Query: 32 NLKRLF 15 + + F Sbjct: 188 AVLKFF 193 >SB_54678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 27.5 bits (58), Expect = 6.4 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -2 Query: 210 CSTRHFLFTPNEILWFTYMSTNLF*LRI 127 C +++F+FT N I+W+ + LF L I Sbjct: 5 CLSKYFIFTLNFIVWYMVVLAVLFTLEI 32 >SB_13598| Best HMM Match : Gurmarin (HMM E-Value=3.3) Length = 194 Score = 27.5 bits (58), Expect = 6.4 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 1/66 (1%) Frame = -3 Query: 209 VAHAIFFLRPTKSSGLRICQRICFNYEYKKMKNNIKPHTGNTRKKYTIRFQV-TVKSDVL 33 V H L SGL +C I + K+ +K T N + ++ + +V KSDVL Sbjct: 128 VTHQAMLLLKVMVSGLVVCPIIEISANQKRAWIALKQKTANHLEGFSKKLEVLNPKSDVL 187 Query: 32 NLKRLF 15 + + F Sbjct: 188 AVLKFF 193 >SB_13044| Best HMM Match : Vps26 (HMM E-Value=0) Length = 669 Score = 27.1 bits (57), Expect = 8.5 Identities = 12/43 (27%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = -3 Query: 158 ICQRICFNYEYKKMKNNIKPHTG-NTRKKYTIRFQVTVK-SDV 36 + Q +C+++E+ ++ + +TG N R +Y +R + + SDV Sbjct: 98 LTQSVCYDFEFVNVEKPYETYTGANVRLRYFLRVTIVRRLSDV 140 >SB_51925| Best HMM Match : DIX (HMM E-Value=0.75) Length = 256 Score = 27.1 bits (57), Expect = 8.5 Identities = 20/78 (25%), Positives = 34/78 (43%) Frame = +1 Query: 154 HIRKPEDFVGRKKKMACATLKRNLDWESKAQLPTKRRRCSPFAASPSTSPGLKTSESKPS 333 H+ KPE + + A + +D E Q +++ +AS ST+ SE P Sbjct: 133 HLTKPEVTLVMNAEDTPANVA--MDVEENQQEVVRKKAEESESASESTATEATPSEVSPI 190 Query: 334 SFGESVSAPVKITPERMA 387 S +P+K TP ++ Sbjct: 191 ETTPSEVSPIKTTPSEVS 208 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,357,085 Number of Sequences: 59808 Number of extensions: 312200 Number of successful extensions: 1003 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 839 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 999 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1062812967 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -