BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1000 (496 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g18760.1 68418.m02228 zinc finger (C3HC4-type RING finger) fa... 32 0.18 At2g36720.1 68415.m04505 PHD finger transcription factor, putative 30 0.98 At1g76810.1 68414.m08938 eukaryotic translation initiation facto... 29 2.3 At2g46550.1 68415.m05807 expressed protein 28 3.0 At5g43740.2 68418.m05348 disease resistance protein (CC-NBS-LRR ... 28 4.0 At5g43740.1 68418.m05347 disease resistance protein (CC-NBS-LRR ... 28 4.0 At5g17770.1 68418.m02084 NADH-cytochrome b5 reductase identical ... 27 6.9 At3g24630.1 68416.m03093 hypothetical protein 27 6.9 At5g61460.1 68418.m07712 structural maintenance of chromosomes (... 27 9.2 At5g53870.1 68418.m06701 plastocyanin-like domain-containing pro... 27 9.2 >At5g18760.1 68418.m02228 zinc finger (C3HC4-type RING finger) family protein predicted proteins, Arabidopsis thaliana ; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 411 Score = 32.3 bits (70), Expect = 0.18 Identities = 25/64 (39%), Positives = 27/64 (42%), Gaps = 11/64 (17%) Frame = +1 Query: 217 RNLDWESKAQLPTKRRRC-----------SPFAASPSTSPGLKTSESKPSSFGESVSAPV 363 RNL + KA LP RR P ASP TSP K S PSS +S V Sbjct: 68 RNLSLKRKASLPNYERRLLLSPSVSETSEKPLVASPITSPYWKRCLSLPSSNSAKLSLVV 127 Query: 364 KITP 375 TP Sbjct: 128 STTP 131 >At2g36720.1 68415.m04505 PHD finger transcription factor, putative Length = 1007 Score = 29.9 bits (64), Expect = 0.98 Identities = 16/67 (23%), Positives = 28/67 (41%) Frame = +1 Query: 172 DFVGRKKKMACATLKRNLDWESKAQLPTKRRRCSPFAASPSTSPGLKTSESKPSSFGESV 351 D+ ++K+ C K + S + CS S ++ +TS S P+ V Sbjct: 365 DYASKEKRFTCKRCKGPFPFSSLGHRGFLCKSCSEVETSQASLAATRTSTSAPACITSPV 424 Query: 352 SAPVKIT 372 + +KIT Sbjct: 425 KSRLKIT 431 >At1g76810.1 68414.m08938 eukaryotic translation initiation factor 2 family protein / eIF-2 family protein similar to IF2 protein [Drosophila melanogaster] GI:7108770; contains Pfam profile PF03144: Elongation factor Tu domain 2 Length = 1294 Score = 28.7 bits (61), Expect = 2.3 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = +1 Query: 226 DWESKAQLPTKRRRCSPFAASPSTSPGLKTSESKPSSFGESVSAPVKITPE 378 D E +AQ K+ + + + P + +KP+ G+ + A VK TPE Sbjct: 618 DEEEEAQPVVKKELKDAISKAHDSEPEAEKPTAKPAGTGKPLIAAVKATPE 668 >At2g46550.1 68415.m05807 expressed protein Length = 397 Score = 28.3 bits (60), Expect = 3.0 Identities = 25/89 (28%), Positives = 40/89 (44%), Gaps = 5/89 (5%) Frame = +1 Query: 187 KKKMACATLKRNLDWESKAQLPTKRRRCSPFAASPS--TSPGLKT-SESKPSSFGESVSA 357 K ++A +R+LD+ LPT ++ + SP S GL+ S S + G S + Sbjct: 188 KDELASLVAQRSLDYVENCDLPTPQKMKRSYYGSPRGFDSDGLRDYSVSGQTIKGTSKGS 247 Query: 358 PVKITPERMAQEIYDEIKRLH--RRGQLR 438 K PE ++ + + L RR Q R Sbjct: 248 SCKNRPEASSESDLSKSELLEALRRSQTR 276 >At5g43740.2 68418.m05348 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 862 Score = 27.9 bits (59), Expect = 4.0 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +1 Query: 196 MACATLKRNLDWESKAQLPTKRRRCSPFAASPST-SPGLK 312 + C + +DWESK +RR SP PST SPG K Sbjct: 711 LMCNISEIRIDWESK-----ERRELSPTEILPSTGSPGFK 745 >At5g43740.1 68418.m05347 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 862 Score = 27.9 bits (59), Expect = 4.0 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +1 Query: 196 MACATLKRNLDWESKAQLPTKRRRCSPFAASPST-SPGLK 312 + C + +DWESK +RR SP PST SPG K Sbjct: 711 LMCNISEIRIDWESK-----ERRELSPTEILPSTGSPGFK 745 >At5g17770.1 68418.m02084 NADH-cytochrome b5 reductase identical to NADH-cytochrome b5 reductase [Arabidopsis thaliana] GI:4240116 Length = 281 Score = 27.1 bits (57), Expect = 6.9 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 2/58 (3%) Frame = -3 Query: 212 NVAHAIFFLRPTKSS--GLRICQRICFNYEYKKMKNNIKPHTGNTRKKYTIRFQVTVK 45 NVA +F L PT +S GL I Q I + + ++ IKP+T T RF++ +K Sbjct: 61 NVAKFVFEL-PTSTSVLGLPIGQHISCRGKDGQGEDVIKPYTPTTLDSDVGRFELVIK 117 >At3g24630.1 68416.m03093 hypothetical protein Length = 724 Score = 27.1 bits (57), Expect = 6.9 Identities = 20/94 (21%), Positives = 41/94 (43%) Frame = +1 Query: 157 IRKPEDFVGRKKKMACATLKRNLDWESKAQLPTKRRRCSPFAASPSTSPGLKTSESKPSS 336 + +PED + + L+ +L S Q +R+ P + S L+ S Sbjct: 103 VSRPED-IAKDLLRGALDLEESLAMLSSIQEDDSKRK--PMIRNDGRSD-LRFQRSMSDR 158 Query: 337 FGESVSAPVKITPERMAQEIYDEIKRLHRRGQLR 438 FGE + + + +++ Y+E++++ R LR Sbjct: 159 FGERIEKRMMVQENVASKDCYEELRKVIRESFLR 192 >At5g61460.1 68418.m07712 structural maintenance of chromosomes (SMC) family protein very strong similarity to SMC-like protein (MIM) [Arabidopsis thaliana] GI:5880614; contains Pfam profile PF02463: RecF/RecN/SMC N terminal domain Length = 1057 Score = 26.6 bits (56), Expect = 9.2 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +1 Query: 310 KTSESKPSSFGESVSAPVKITPERMAQEIYDEIKRLHRRGQ 432 K SE P S ES+ TPE+++ +I +RLHR Q Sbjct: 827 KASEICPESEIESLGPWDGSTPEQLSAQITRMNQRLHRENQ 867 >At5g53870.1 68418.m06701 plastocyanin-like domain-containing protein contains similarity to SP|Q02917 Early nodulin 55-2 precursor {Glycine max}; PF02298: Plastocyanin-like domain Length = 370 Score = 26.6 bits (56), Expect = 9.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 280 AASPSTSPGLKTSESKPSSFGESVSAPVKITPE 378 A SPS SP S S SS +S + P +TP+ Sbjct: 266 AHSPSHSPATPKSPSPSSSPAQSPATPSPMTPQ 298 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,844,574 Number of Sequences: 28952 Number of extensions: 219850 Number of successful extensions: 651 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 632 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 651 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 868578304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -