BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0996 (477 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-tran... 28 0.15 >AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-transferase e8 protein. Length = 217 Score = 28.3 bits (60), Expect = 0.15 Identities = 25/95 (26%), Positives = 39/95 (41%), Gaps = 3/95 (3%) Frame = +1 Query: 1 VLIGVAFLTLLERKVLGYIQIRKGPNKVGFIGLLQPFSDAIKLFTKERTYPNFSN---YF 171 VL+ +A L + +R L YI + KG + + P L E T + Y Sbjct: 15 VLLAIAALGVKDRIKLEYIDLFKGGHLSSDYLKINPLHTVPVLRHGELTLTDSHAILVYL 74 Query: 172 CYYFSPVFRFIXXXXXXXXIPYIYNLICFNLGILF 276 C F+P + ++N++CFN G LF Sbjct: 75 CDTFAPPGHTLALPDALTRAK-VFNMLCFNNGCLF 108 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 261,683 Number of Sequences: 2352 Number of extensions: 4236 Number of successful extensions: 26 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 42095889 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -