BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0994 (650 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578802-1|AAT07307.1| 108|Anopheles gambiae FK506-binding prot... 181 2e-47 >AY578802-1|AAT07307.1| 108|Anopheles gambiae FK506-binding protein protein. Length = 108 Score = 181 bits (440), Expect = 2e-47 Identities = 79/108 (73%), Positives = 95/108 (87%) Frame = +3 Query: 129 MGVDVETISPGNGSTYPKPGQTVVVHYTGTLQNGKKFDSSRDRGQPFKFTLGKGDVIKGW 308 MGV + I+ G+ +T+PKPGQT VVHYTGTL +G FDSSR RG+PFKF++GKG+VI+GW Sbjct: 1 MGVQIVPIANGDQTTFPKPGQTAVVHYTGTLDDGTVFDSSRTRGKPFKFSVGKGEVIRGW 60 Query: 309 DQGLAKMSVGERAKLTCSPDFAYGSRGHPGVIPPNATLIFDVELLRVE 452 D+G+A+MSVG+RAKL CSPD+AYGSRGHPGVIPPNA L FDVELLRVE Sbjct: 61 DEGVAQMSVGQRAKLVCSPDYAYGSRGHPGVIPPNARLTFDVELLRVE 108 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 672,494 Number of Sequences: 2352 Number of extensions: 13687 Number of successful extensions: 12 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -