BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0993 (723 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 23 2.9 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 23 3.9 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 3.9 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -3 Query: 280 ISGSRWFLWSRFWNSGTG 227 +S + WF W NSG G Sbjct: 610 LSSAVWFAWGVLLNSGIG 627 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 22.6 bits (46), Expect = 3.9 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -2 Query: 350 WRPERRGLLLWTVCWLREGCRWSYLRQPLVSL 255 +R +RRG + +T+ +RE R Y ++ + L Sbjct: 133 YRSKRRGFVYYTMGQIREVARHFYHKELQIEL 164 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.6 bits (46), Expect = 3.9 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +3 Query: 516 ASELRTPTVTAPDADPFPTSPPLPTRA 596 A+ L + AP + PTS P TRA Sbjct: 111 ANPLLAEKLAAPSSQASPTSIPYATRA 137 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,775 Number of Sequences: 438 Number of extensions: 2139 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -