BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0991 (398 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g49600.1 68416.m05421 ubiquitin-specific protease 26 (UBP26) ... 31 0.28 At5g24850.1 68418.m02938 cryptochrome dash (CRYD) nearly identic... 26 8.0 >At3g49600.1 68416.m05421 ubiquitin-specific protease 26 (UBP26) similar to GI:11993492; RNA binding protein - Homo sapiens, EMBL:AB016089 (N-terminus), several ubiquitin carboxyl-terminal hydrolases from aa pos. 712 Length = 1067 Score = 31.1 bits (67), Expect = 0.28 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +2 Query: 215 LCLVRSKSGETLMEDRSDSDVQIDRRNWV*GRKTN 319 +C VR K M + SDS ++DRR R+TN Sbjct: 928 VCFVRGKEAPKAMLEASDSSFEVDRRTSKRSRRTN 962 >At5g24850.1 68418.m02938 cryptochrome dash (CRYD) nearly identical to cryptochrome dash [Arabidopsis thaliana] GI:28971609; similar to Deoxyribodipyrimidine photolyase (DNA photolyase) (Photoreactivating enzyme)(SP:Q55081){Synechocystis sp.} Length = 526 Score = 26.2 bits (55), Expect = 8.0 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -3 Query: 303 YTQFRRSICTSESLRSSIRV 244 YTQFR+S+ S+RSS R+ Sbjct: 195 YTQFRKSVEAKCSIRSSTRI 214 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,120,322 Number of Sequences: 28952 Number of extensions: 163158 Number of successful extensions: 358 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 355 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 358 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 575830496 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -