BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0990 (513 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7724| Best HMM Match : ATP-synt_ab_C (HMM E-Value=0) 186 7e-48 SB_55653| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-05 SB_40036| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.32 SB_44024| Best HMM Match : Flavin_Reduct (HMM E-Value=0.79) 30 1.3 SB_53344| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_12626| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_24994| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_37000| Best HMM Match : Astacin (HMM E-Value=5.5e-19) 27 6.9 SB_11978| Best HMM Match : Myb_DNA-binding (HMM E-Value=8e-21) 27 9.1 SB_23856| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_16998| Best HMM Match : Filamin (HMM E-Value=0.0037) 27 9.1 >SB_7724| Best HMM Match : ATP-synt_ab_C (HMM E-Value=0) Length = 448 Score = 186 bits (454), Expect = 7e-48 Identities = 86/103 (83%), Positives = 96/103 (93%) Frame = +1 Query: 205 DVQFEDNLPPILNALEVQNRSPRLVLEVAQHLGENTVRTIAMDGTEGLVRGQPVLDSGSP 384 DVQF+++LPPILNALEV+NR+PRL+LEVAQHLGENTVRTIAMDGTEGL+RGQ +D+G P Sbjct: 85 DVQFDEDLPPILNALEVENRTPRLILEVAQHLGENTVRTIAMDGTEGLIRGQKCVDTGGP 144 Query: 385 IRIPVGAETLGRIINVIGEPIDERGPIPTDKTAAIHAEAPEFV 513 I IPVG ETLGRIINVIGEPIDERGP+ TDK AAIHAEAPEFV Sbjct: 145 ITIPVGPETLGRIINVIGEPIDERGPVETDKRAAIHAEAPEFV 187 >SB_55653| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 390 Score = 44.0 bits (99), Expect = 7e-05 Identities = 21/65 (32%), Positives = 39/65 (60%), Gaps = 1/65 (1%) Frame = +1 Query: 322 IAMDGTEGLVR-GQPVLDSGSPIRIPVGAETLGRIINVIGEPIDERGPIPTDKTAAIHAE 498 + + G + L++ G V +G+ + +PVG E LGR+++ +G PID +GP + A + + Sbjct: 12 VVVFGNDRLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNPIDGKGPTGGTR-ARVGVK 70 Query: 499 APEFV 513 AP + Sbjct: 71 APGII 75 >SB_40036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 232 Score = 31.9 bits (69), Expect = 0.32 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = -1 Query: 315 NCVLTQMLGYLKYEAGRSILHLKGI*NRRQVIFEL-HIYHSTDNGNNLTLAFSCRFSS 145 NC+L + GYLK ++ I++ G QV++ L +Y S + GNNL F +S Sbjct: 48 NCLLWTIYGYLKDDSTIIIVNFVGA--LLQVVYILCFLYFSRERGNNLAFLFYSAIAS 103 >SB_44024| Best HMM Match : Flavin_Reduct (HMM E-Value=0.79) Length = 308 Score = 29.9 bits (64), Expect = 1.3 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = -2 Query: 440 SPITLMMRPRV-SAPTGIRIGEPESSTG 360 S +T +P SAPTGI G+P SSTG Sbjct: 112 STLTAFGQPSTTSAPTGISFGQPTSSTG 139 >SB_53344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 28.7 bits (61), Expect = 3.0 Identities = 23/69 (33%), Positives = 29/69 (42%) Frame = -2 Query: 506 SGASA*IAAVLSVGMGPRSSIGSPITLMMRPRVSAPTGIRIGEPESSTGCPRTKPSVPSM 327 SG+S+ A +L GP SS+ P T P PTG+ + P S P P P M Sbjct: 671 SGSSS--AQMLPPMPGPPSSMSGPTTSRHGP---PPTGLTMNPPTSMGMAPMMPPPGPGM 725 Query: 326 AMVRTVFSP 300 SP Sbjct: 726 GTHPQQVSP 734 >SB_12626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 363 Score = 28.7 bits (61), Expect = 3.0 Identities = 16/32 (50%), Positives = 18/32 (56%) Frame = +1 Query: 376 GSPIRIPVGAETLGRIINVIGEPIDERGPIPT 471 G PI P+G +GR I IG PI GPI T Sbjct: 283 GRPIGRPIGL--IGRPIGPIGRPIGPIGPIGT 312 >SB_24994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1122 Score = 27.9 bits (59), Expect = 5.2 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = +1 Query: 355 GQPVLDSGSPIRIPVGAETL--GRIINVIGEPIDERGP 462 GQP D+G P G + G+++N GEP++ GP Sbjct: 94 GQPANDTGQPSS-NAGQPLINTGQLVNNTGEPVNNTGP 130 >SB_37000| Best HMM Match : Astacin (HMM E-Value=5.5e-19) Length = 1341 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -1 Query: 231 RQVIFELHIYHSTDNGNNLTLAF 163 RQ H +HS D+ NNLT AF Sbjct: 518 RQPYVTTHNHHSHDHNNNLTTAF 540 >SB_11978| Best HMM Match : Myb_DNA-binding (HMM E-Value=8e-21) Length = 636 Score = 27.1 bits (57), Expect = 9.1 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +1 Query: 214 FEDNLPPILNALEVQNRSPRLVLEVAQHLGENTVRTIAMDGT 339 F++++ P+LN L + +S L L ++ G N V +GT Sbjct: 174 FQESVCPVLNTLTLHIKSSELDLNRPRNRGSNKVENGKNEGT 215 >SB_23856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -3 Query: 274 GGEIDFAPQGHLESEAGYLRIAHL 203 G ID +P G +E E +LRI H+ Sbjct: 54 GYVIDVSPDGRVEMEKDHLRITHM 77 >SB_16998| Best HMM Match : Filamin (HMM E-Value=0.0037) Length = 284 Score = 27.1 bits (57), Expect = 9.1 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = +2 Query: 317 GPLPWTVLKA*SVGNPY*TLAHQ-FVSRWELKPS 415 G + W + A V +P T AH+ FVS+WEL+P+ Sbjct: 75 GSMRWDMRAA--VRSPARTNAHKSFVSKWELQPA 106 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,299,152 Number of Sequences: 59808 Number of extensions: 343426 Number of successful extensions: 854 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 744 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 824 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1136110413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -