BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0990 (513 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g08690.1 68418.m01034 ATP synthase beta chain 2, mitochondria... 141 3e-34 At5g08680.1 68418.m01033 ATP synthase beta chain, mitochondrial,... 141 3e-34 At5g08670.1 68418.m01032 ATP synthase beta chain 1, mitochondria... 141 3e-34 At2g07698.1 68415.m00949 ATP synthase alpha chain, mitochondrial... 44 6e-05 At4g38510.2 68417.m05447 vacuolar ATP synthase subunit B, putati... 35 0.028 At4g38510.1 68417.m05446 vacuolar ATP synthase subunit B, putati... 35 0.028 At1g76030.1 68414.m08827 vacuolar ATP synthase subunit B / V-ATP... 35 0.037 At1g20260.2 68414.m02530 vacuolar ATP synthase subunit B, putati... 35 0.037 At1g20260.1 68414.m02529 vacuolar ATP synthase subunit B, putati... 35 0.037 At3g54040.1 68416.m05975 photoassimilate-responsive protein-rela... 31 0.46 At2g33860.1 68415.m04157 auxin-responsive factor (ARF3) / ETTIN ... 30 1.1 At4g34340.1 68417.m04880 expressed protein 29 1.8 At5g60450.1 68418.m07582 auxin-responsive factor (ARF4) contains... 27 5.6 At3g62640.1 68416.m07036 expressed protein 27 5.6 At2g33640.1 68415.m04124 zinc finger (DHHC type) family protein ... 27 5.6 At5g39880.1 68418.m04837 expressed protein 27 7.4 At2g33100.1 68415.m04058 cellulose synthase family protein simil... 27 9.8 At1g51910.1 68414.m05851 protein kinase family protein contains ... 27 9.8 >At5g08690.1 68418.m01034 ATP synthase beta chain 2, mitochondrial identical to SP|P83484 ATP synthase beta chain 2, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}; strong similarity to SP|P17614 ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) {Nicotiana plumbaginifolia}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain; supporting cDNA gi|26452187|dbj|AK118582.1| Length = 556 Score = 141 bits (341), Expect = 3e-34 Identities = 68/105 (64%), Positives = 83/105 (79%), Gaps = 2/105 (1%) Frame = +1 Query: 205 DVQFEDN--LPPILNALEVQNRSPRLVLEVAQHLGENTVRTIAMDGTEGLVRGQPVLDSG 378 DV+FED LPPI+ +LEVQ+ RLVLEV+ HLG+N VRTIAMDGTEGLVRG+ VL++G Sbjct: 95 DVRFEDQEGLPPIMTSLEVQDHPTRLVLEVSHHLGQNVVRTIAMDGTEGLVRGRKVLNTG 154 Query: 379 SPIRIPVGAETLGRIINVIGEPIDERGPIPTDKTAAIHAEAPEFV 513 +PI +PVG TLGRI+NV+GEPIDERG I T+ IH +AP V Sbjct: 155 APITVPVGRATLGRIMNVLGEPIDERGEIKTEHYLPIHRDAPALV 199 >At5g08680.1 68418.m01033 ATP synthase beta chain, mitochondrial, putative strong similarity to SP|P83483 ATP synthase beta chain 1, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}, SP|P17614 ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) {Nicotiana plumbaginifolia}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 559 Score = 141 bits (341), Expect = 3e-34 Identities = 68/105 (64%), Positives = 83/105 (79%), Gaps = 2/105 (1%) Frame = +1 Query: 205 DVQFEDN--LPPILNALEVQNRSPRLVLEVAQHLGENTVRTIAMDGTEGLVRGQPVLDSG 378 DV+FED LPPI+ +LEVQ+ RLVLEV+ HLG+N VRTIAMDGTEGLVRG+ VL++G Sbjct: 98 DVRFEDQEGLPPIMTSLEVQDHPTRLVLEVSHHLGQNVVRTIAMDGTEGLVRGRKVLNTG 157 Query: 379 SPIRIPVGAETLGRIINVIGEPIDERGPIPTDKTAAIHAEAPEFV 513 +PI +PVG TLGRI+NV+GEPIDERG I T+ IH +AP V Sbjct: 158 APITVPVGRATLGRIMNVLGEPIDERGEIKTEHYLPIHRDAPALV 202 >At5g08670.1 68418.m01032 ATP synthase beta chain 1, mitochondrial identical to SP|P83483 ATP synthase beta chain 1, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}; strong similarity to SP|P17614 ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) {Nicotiana plumbaginifolia}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain; supporting cDNA gi|26452102|dbj|AK118538.1| Length = 556 Score = 141 bits (341), Expect = 3e-34 Identities = 68/105 (64%), Positives = 83/105 (79%), Gaps = 2/105 (1%) Frame = +1 Query: 205 DVQFEDN--LPPILNALEVQNRSPRLVLEVAQHLGENTVRTIAMDGTEGLVRGQPVLDSG 378 DV+FED LPPI+ +LEVQ+ RLVLEV+ HLG+N VRTIAMDGTEGLVRG+ VL++G Sbjct: 95 DVRFEDQEGLPPIMTSLEVQDHPTRLVLEVSHHLGQNVVRTIAMDGTEGLVRGRKVLNTG 154 Query: 379 SPIRIPVGAETLGRIINVIGEPIDERGPIPTDKTAAIHAEAPEFV 513 +PI +PVG TLGRI+NV+GEPIDERG I T+ IH +AP V Sbjct: 155 APITVPVGRATLGRIMNVLGEPIDERGEIKTEHYLPIHRDAPALV 199 >At2g07698.1 68415.m00949 ATP synthase alpha chain, mitochondrial, putative very strong similarity to SP|P23413 ATP synthase alpha chain, mitochondrial (EC 3.6.3.14) {Brassica campestris}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 777 Score = 44.0 bits (99), Expect = 6e-05 Identities = 20/73 (27%), Positives = 36/73 (49%) Frame = +1 Query: 286 VAQHLGENTVRTIAMDGTEGLVRGQPVLDSGSPIRIPVGAETLGRIINVIGEPIDERGPI 465 +A +L V + G + G V +GS + +P G LGR+++ +G PID +G + Sbjct: 334 MALNLENENVGIVVFGGDTAIKEGDLVKRTGSIVDVPAGKAMLGRVVDAMGVPIDGKGAL 393 Query: 466 PTDKTAAIHAEAP 504 + + +AP Sbjct: 394 SDHEQRRVEVKAP 406 >At4g38510.2 68417.m05447 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative very strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 487 Score = 35.1 bits (77), Expect = 0.028 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +1 Query: 301 GENTVRTIAMDGTEGLVRGQPVLD-SGSPIRIPVGAETLGRIINVIGEPIDERGPI 465 GE V + +GT G+ + +G ++ PV + LGRI N G+PID PI Sbjct: 64 GEKAVVQV-FEGTSGIDNKYTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPI 118 >At4g38510.1 68417.m05446 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative very strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 487 Score = 35.1 bits (77), Expect = 0.028 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +1 Query: 301 GENTVRTIAMDGTEGLVRGQPVLD-SGSPIRIPVGAETLGRIINVIGEPIDERGPI 465 GE V + +GT G+ + +G ++ PV + LGRI N G+PID PI Sbjct: 64 GEKAVVQV-FEGTSGIDNKYTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPI 118 >At1g76030.1 68414.m08827 vacuolar ATP synthase subunit B / V-ATPase B subunit / vacuolar proton pump B subunit / V-ATPase 57 kDa subunit identical to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana} Length = 486 Score = 34.7 bits (76), Expect = 0.037 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = +1 Query: 301 GENTVRTIAMDGTEGLV-RGQPVLDSGSPIRIPVGAETLGRIINVIGEPIDERGPI 465 GE V + +GT G+ + V +G ++ PV + LGRI N G+PID PI Sbjct: 63 GEKAVVQV-FEGTSGIDNKFTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPI 117 >At1g20260.2 68414.m02530 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 485 Score = 34.7 bits (76), Expect = 0.037 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = +1 Query: 301 GENTVRTIAMDGTEGLV-RGQPVLDSGSPIRIPVGAETLGRIINVIGEPIDERGPI 465 GE V + +GT G+ + V +G ++ PV + LGRI N G+PID PI Sbjct: 63 GEKAVVQV-FEGTSGIDNKFTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPI 117 >At1g20260.1 68414.m02529 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 330 Score = 34.7 bits (76), Expect = 0.037 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = +1 Query: 301 GENTVRTIAMDGTEGLV-RGQPVLDSGSPIRIPVGAETLGRIINVIGEPIDERGPI 465 GE V + +GT G+ + V +G ++ PV + LGRI N G+PID PI Sbjct: 63 GEKAVVQV-FEGTSGIDNKFTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPI 117 >At3g54040.1 68416.m05975 photoassimilate-responsive protein-related contains weak similarity to mRNA inducible by sucrose and salicylic acid expressed in sugar-accumulating tobacco plants (GI:871487) [Nicotiana tabacum] Length = 183 Score = 31.1 bits (67), Expect = 0.46 Identities = 17/44 (38%), Positives = 24/44 (54%) Frame = +1 Query: 220 DNLPPILNALEVQNRSPRLVLEVAQHLGENTVRTIAMDGTEGLV 351 +NLP + + + R +LE A GE T RT A+D EG+V Sbjct: 29 ENLPTNMCSFSISASGKRCILETANVAGEFTCRTSAVD-VEGIV 71 >At2g33860.1 68415.m04157 auxin-responsive factor (ARF3) / ETTIN protein (ETT) identical to ETTIN GB:AF007788 from [Arabidopsis thaliana] Length = 608 Score = 29.9 bits (64), Expect = 1.1 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -3 Query: 310 CSHPNVGLPQVRGGEIDFAPQGHLESEAGY-LRIAHLPQH 194 C+ P + LP+ RG + + PQGHLE + I LP H Sbjct: 59 CAGPLISLPK-RGSLVLYFPQGHLEQAPDFSAAIYGLPPH 97 >At4g34340.1 68417.m04880 expressed protein Length = 353 Score = 29.1 bits (62), Expect = 1.8 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -1 Query: 465 DGTTLVNRFADYIDDATEGFSSHRDTNW 382 DG +++ FA ++ A +GFSS T W Sbjct: 259 DGLSVIEAFAPAMEAARDGFSSEAHTEW 286 >At5g60450.1 68418.m07582 auxin-responsive factor (ARF4) contains Pfam profile: PF02362 B3 DNA binding domain; identical to cDNA auxin response factor 4 (ARF4) GI:4102597 Length = 788 Score = 27.5 bits (58), Expect = 5.6 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -3 Query: 310 CSHPNVGLPQVRGGEIDFAPQGHLESEA 227 C+ P LP+ +G + + PQGHLE +A Sbjct: 70 CAGPLTCLPK-KGNVVVYFPQGHLEQDA 96 >At3g62640.1 68416.m07036 expressed protein Length = 110 Score = 27.5 bits (58), Expect = 5.6 Identities = 16/65 (24%), Positives = 27/65 (41%) Frame = -2 Query: 410 VSAPTGIRIGEPESSTGCPRTKPSVPSMAMVRTVFSPKCWATSSTRRGDRFCTSRAFRIG 231 V T + P+S P P S + RT +P + T+R R T + + + Sbjct: 27 VGGTTQVYSTRPDSPKFQPSIPPPPGSTSKTRTTATPWRLIDAETKRKKRIATYKTYALE 86 Query: 230 GRLSS 216 G++ S Sbjct: 87 GKVKS 91 >At2g33640.1 68415.m04124 zinc finger (DHHC type) family protein contains Pfam profile PF01529: DHHC zinc finger domain Length = 565 Score = 27.5 bits (58), Expect = 5.6 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -3 Query: 418 DRGFQLP-PGYELVSQSLVRVAHGLSLQYRPWQWSELCSHPNVGLPQ 281 D+ Q P P V+ + R + GLS+QYR + LC+ PN+ + Q Sbjct: 295 DQTSQYPSPASSAVTATSARSSLGLSIQYR---GASLCTPPNIFVDQ 338 >At5g39880.1 68418.m04837 expressed protein Length = 363 Score = 27.1 bits (57), Expect = 7.4 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +2 Query: 113 LQSMPLTRGTMLLNLQEKAKVRLLPLSVLW*MCNSKITCL 232 LQ++P T T +LN +E++ + ++ MC +T L Sbjct: 44 LQTLPFTEITEILNRKERSAPKTPEFKAMFTMCKGYVTYL 83 >At2g33100.1 68415.m04058 cellulose synthase family protein similar to gi:2827143 from Arabidopsis thaliana (Ath-B) Length = 1036 Score = 26.6 bits (56), Expect = 9.8 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -2 Query: 392 IRIGEPESSTGCPRTKPSVPSMAMVRTVFSPKCWATSSTRRGDR 261 ++ G P + PR P++A V S CW +T GDR Sbjct: 689 VKNGRPPGALLLPRPPLDAPTVAEAIAVIS--CWYEDNTEWGDR 730 >At1g51910.1 68414.m05851 protein kinase family protein contains Serine/Threonine protein kinases active-site signature, PROSITE:PS00108 Length = 876 Score = 26.6 bits (56), Expect = 9.8 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 226 LPPILNALEVQNRSPRLVLEVAQ 294 LPP++NALEV L+LE Q Sbjct: 343 LPPLINALEVYTLVENLLLETYQ 365 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,556,641 Number of Sequences: 28952 Number of extensions: 243350 Number of successful extensions: 628 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 628 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 927799552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -