BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0983 (600 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g11780.1 68414.m01352 oxidoreductase, 2OG-Fe(II) oxygenase fa... 32 0.25 At2g42780.1 68415.m05297 expressed protein 32 0.33 At1g49270.1 68414.m05524 protein kinase family protein contains ... 29 1.8 At1g61370.1 68414.m06916 S-locus lectin protein kinase family pr... 29 3.1 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 28 4.1 At4g15740.1 68417.m02396 C2 domain-containing protein similar to... 28 5.4 At1g31250.1 68414.m03825 proline-rich family protein contains pr... 28 5.4 At1g06710.1 68414.m00713 pentatricopeptide (PPR) repeat-containi... 28 5.4 At5g57200.1 68418.m07145 epsin N-terminal homology (ENTH) domain... 27 7.2 At5g15980.1 68418.m01868 pentatricopeptide (PPR) repeat-containi... 27 7.2 At3g24550.1 68416.m03083 protein kinase family protein contains ... 27 7.2 At3g08760.1 68416.m01018 protein kinase family protein contains ... 27 7.2 At2g22530.1 68415.m02672 phosphatidylinositolglycan-related simi... 27 7.2 At1g75260.1 68414.m08743 isoflavone reductase family protein sim... 27 7.2 At1g61360.1 68414.m06915 S-locus lectin protein kinase family pr... 27 7.2 At1g10870.1 68414.m01249 ARF GTPase-activating domain-containing... 27 7.2 At1g77220.1 68414.m08994 expressed protein contains Pfam profile... 27 9.5 At1g52340.1 68414.m05908 short-chain dehydrogenase/reductase (SD... 27 9.5 At1g19940.1 68414.m02499 glycosyl hydrolase family 9 protein sim... 27 9.5 >At1g11780.1 68414.m01352 oxidoreductase, 2OG-Fe(II) oxygenase family protein low similarity to alkB proteins from Homo sapiens [SP|Q13686], Caulobacter crescentus [GI:2055386]; contains Pfam profile PF03171: oxidoreductase, 2OG-Fe(II) oxygenase family Length = 345 Score = 32.3 bits (70), Expect = 0.25 Identities = 22/67 (32%), Positives = 35/67 (52%) Frame = +2 Query: 365 ISMHQQALYNQQSTYTNIPTSPNISYSTKPNGPPIEDLFDTIKSNEPSVNKSLYNDHRFS 544 +S+ +Q + ++S T+ P PN + GP I+DLFD+ K N+ V L N+ Sbjct: 94 LSLKEQCKWIKESL-TSFPQPPNRTNHNAIYGP-IDDLFDSAKENKVLVQDDLTNNK--- 148 Query: 545 WLWK*YD 565 WK Y+ Sbjct: 149 --WKFYE 153 >At2g42780.1 68415.m05297 expressed protein Length = 293 Score = 31.9 bits (69), Expect = 0.33 Identities = 14/53 (26%), Positives = 27/53 (50%) Frame = +2 Query: 56 LLSKLKVGTLRLKEIKRANLVAKSYTYKRFTKMEPMTLGSPTHSPSGSPNVGY 214 ++ K K+ L+ +E+K + ++ K F+ P G +SPS S ++ Y Sbjct: 169 IMKKAKIDLLKSQEVKNLTAIKRNTIQKSFSISTPKKTGLSANSPSTSRSIPY 221 >At1g49270.1 68414.m05524 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 699 Score = 29.5 bits (63), Expect = 1.8 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = +2 Query: 353 YRQNISMHQQALYNQQSTYTNIPTSPNISYSTKPNGPP 466 Y QN + QQ YNQ N+P P + + PP Sbjct: 229 YNQNAATQQQQHYNQNDHIVNLPPPPGSMGTNWVSSPP 266 >At1g61370.1 68414.m06916 S-locus lectin protein kinase family protein contains Pfam domains, PF00954: S-locus glycoprotein family, PF00069: Protein kinase domain, and PF01453: Lectin (probable mannose binding) Length = 814 Score = 28.7 bits (61), Expect = 3.1 Identities = 11/51 (21%), Positives = 25/51 (49%) Frame = +2 Query: 71 KVGTLRLKEIKRANLVAKSYTYKRFTKMEPMTLGSPTHSPSGSPNVGYLPP 223 K+G + + ++ S + T+ P+++G SP+G+ +G+ P Sbjct: 3 KIGIVFFASLLFLLIIFPSCAFAAITRASPLSIGQTLSSPNGTYELGFFSP 53 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 28.3 bits (60), Expect = 4.1 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +2 Query: 158 PMTLGSP--THSPSGSPNVGYLPPFLLGEINPPTTPRTNSLSPTKG 289 P+T+ SP T SP GSP + P P +P T+ +PT G Sbjct: 433 PITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTPG 478 >At4g15740.1 68417.m02396 C2 domain-containing protein similar to cold-regulated gene SRC2 [Glycine max] GI:2055230; contains Pfam profile PF00168: C2 domain Length = 468 Score = 27.9 bits (59), Expect = 5.4 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = +2 Query: 398 QSTYTNIPTSPNISYSTKPNGPPIEDLFDTIKSNEPSVNKSLYND 532 ++T + T+ ++SY KP P+E+ + + PS+ K +Y D Sbjct: 165 KATEKSTNTTVSLSYRFKP--VPVEEFYPPSPDSLPSIGKPVYRD 207 >At1g31250.1 68414.m03825 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; similar to prolin rich protein GB:S44189 GI:433706 from [Zea mays] Length = 165 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = +2 Query: 176 PTHSPSGSPNVGYLPPFLLGEINPP-TTPRTN-SLSP 280 P +P+ SP+V PP+ + P TTP + SL+P Sbjct: 109 PAGTPNASPSVKLTPPYASPSVRPTGTTPNASPSLTP 145 >At1g06710.1 68414.m00713 pentatricopeptide (PPR) repeat-containing protein low similarity to fertility restorer [Petunia x hybrida] GI:22128587; contains Pfam profile PF01535: PPR repeat Length = 946 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +2 Query: 26 TYTCLSTRI*LLSKLKVGTLRLKEIKRANLVAKSYTY 136 TY+ + + SK+++ L +E+KR LVA YTY Sbjct: 444 TYSKVLNYLCNASKMELAFLLFEEMKRGGLVADVYTY 480 >At5g57200.1 68418.m07145 epsin N-terminal homology (ENTH) domain-containing protein / clathrin assembly protein-related low similarity to clathrin assembly protein AP180 [Xenopus laevis] GI:6492344; contains Pfam profile PF01417: ENTH domain Length = 591 Score = 27.5 bits (58), Expect = 7.2 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Frame = +2 Query: 356 RQNISMHQQALYNQQ-STYTNIPTSPNISYSTKPNGPPIEDLFDTIKSNEPSVNKSLYN 529 +Q + M+ Q+ YN S Y + SPN S S+ PN P D F + + S + Y+ Sbjct: 529 QQMMMMNNQSPYNNNYSPYHHHQFSPNPSTSSSPN--PFGDPFLALPAPPSSTTQQQYS 585 >At5g15980.1 68418.m01868 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 668 Score = 27.5 bits (58), Expect = 7.2 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 455 NGPPIEDLFDTIKSNEPSVNKSL 523 N P + +LF+T+K NE +V K L Sbjct: 642 NNPDVLELFNTMKPNESAVEKPL 664 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 27.5 bits (58), Expect = 7.2 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +2 Query: 146 TKMEPMTLGSPTHSPSGSPN-VGYLPPFLLGEINPPTTPRTNSLSP 280 T P PT+S + +P PP +PP +P TNS SP Sbjct: 9 TTPSPSPPSPPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSP 54 >At3g08760.1 68416.m01018 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 557 Score = 27.5 bits (58), Expect = 7.2 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +2 Query: 242 NPPTTPRTNSLSPTKGRNLAF 304 +P PR S+SPT+GR L F Sbjct: 501 SPSPPPRRPSVSPTRGRTLVF 521 >At2g22530.1 68415.m02672 phosphatidylinositolglycan-related similar to Pig-o [Mus musculus] GI:8099973 Length = 897 Score = 27.5 bits (58), Expect = 7.2 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = -1 Query: 498 LLFIVSNKSSMGGPFGLVE*D--MLGEVGILVYVLCWLYSACWCI 370 LL I S +S+ P+ + D L EVG +Y++ Y CWC+ Sbjct: 688 LLSISSIGASLVLPWSALNKDKSFLAEVGDCLYLIGSAYILCWCL 732 >At1g75260.1 68414.m08743 isoflavone reductase family protein similar to SP|P52577 Isoflavone reductase homolog P3 (EC 1.3.1.-) {Arabidopsis thaliana}; contains Pfam profile PF02716: Isoflavone reductase Length = 593 Score = 27.5 bits (58), Expect = 7.2 Identities = 17/52 (32%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Frame = +2 Query: 143 FTKMEPMTLGSPTHSPSGSPNVGYLPPFLLGEINPPTTPRTN-SLSPTKGRN 295 F+ P + S T SPS P PPF I P+ T SP+ R+ Sbjct: 11 FSSNSPSRISSGTSSPSPPPTPPSRPPFRPAGIAQPSKSETKPKASPSLSRS 62 >At1g61360.1 68414.m06915 S-locus lectin protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains S-locus glycoprotein family domain, Pfam:PF00954 Length = 821 Score = 27.5 bits (58), Expect = 7.2 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 125 SYTYKRFTKMEPMTLGSPTHSPSGSPNVGY 214 SY Y T P+++G SP GS +G+ Sbjct: 16 SYGYAAITTSSPLSIGVTLSSPGGSYELGF 45 >At1g10870.1 68414.m01249 ARF GTPase-activating domain-containing protein Length = 775 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 402 AHILIFRLHPTYLTRLSRMVHPLKTYSTQ*KAMSRL 509 AH+ F+L L +L +H + TY+ Q K S++ Sbjct: 198 AHLRYFKLGYDLLNQLEPFIHQILTYAQQSKEQSKI 233 >At1g77220.1 68414.m08994 expressed protein contains Pfam profile PF03619: Domain of unknown function Length = 484 Score = 27.1 bits (57), Expect = 9.5 Identities = 12/43 (27%), Positives = 23/43 (53%) Frame = -1 Query: 213 YPTLGLPEGECVGLPSVIGSIFVNLLYVYDLATKFARLISFNR 85 +P LG+ G+ + P + S+FV + + + F L S+N+ Sbjct: 28 HPNLGVDSGQYLTWPILSASVFVVIAILLPMYLIFEHLASYNQ 70 >At1g52340.1 68414.m05908 short-chain dehydrogenase/reductase (SDR) family protein similar to stem secoisolariciresinol dehydrogenase GI:13752458 from [Forsythia x intermedia] Length = 285 Score = 27.1 bits (57), Expect = 9.5 Identities = 20/51 (39%), Positives = 23/51 (45%) Frame = -1 Query: 258 GVVGGFISPSRKGGKYPTLGLPEGECVGLPSVIGSIFVNLLYVYDLATKFA 106 GVVGG S G K+ LGL L I VN + Y +ATK A Sbjct: 163 GVVGGVGPHSYVGSKHAVLGLTRSVAAELGQ--HGIRVNCVSPYAVATKLA 211 >At1g19940.1 68414.m02499 glycosyl hydrolase family 9 protein similar to endo-beta-1,4-D-glucanase GI:4165132 from [Lycopersicon esculentum] Length = 515 Score = 27.1 bits (57), Expect = 9.5 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +2 Query: 425 SPNISYSTKPNGPPIEDLFDTIKSNEPSVNKSLYN 529 +PN++Y GP + D F ++N S YN Sbjct: 460 NPNVAYGALVGGPFLNDTFIDARNNSMQNEPSTYN 494 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,405,744 Number of Sequences: 28952 Number of extensions: 263680 Number of successful extensions: 753 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 717 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 752 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1187288784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -