BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0982 (531 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein p... 24 2.8 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 4.8 AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. 23 8.4 >AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein protein. Length = 455 Score = 24.2 bits (50), Expect = 2.8 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -2 Query: 470 DLQQQVFFPQQPEHSPELQPRP 405 DLQQ+ +Q +H P QP P Sbjct: 118 DLQQKNQMKRQQQHQPPQQPGP 139 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.4 bits (48), Expect = 4.8 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 3/50 (6%) Frame = +2 Query: 374 RVLDPFTIKPL--DEAAVLENARAAEGRI-LVVEDHYQAGGVGEAVLSAV 514 ++L KP+ D++ A + +I ++VED GVGE L+ + Sbjct: 1056 QILQDIQSKPIVIDDSEFAGKLHAVQEKIDILVEDAKSGSGVGEKTLNEI 1105 >AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. Length = 753 Score = 22.6 bits (46), Expect = 8.4 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -2 Query: 476 DNDLQQQVFFPQQPEHSPELQPRP 405 +N L+ QQP+ P QP+P Sbjct: 274 NNGLRAPPSSQQQPQQQPSQQPQP 297 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 532,184 Number of Sequences: 2352 Number of extensions: 12341 Number of successful extensions: 46 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49051644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -