BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0981 (689 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g26610.2 68418.m03181 D111/G-patch domain-containing protein ... 30 1.3 At5g26610.1 68418.m03180 D111/G-patch domain-containing protein ... 30 1.3 At4g27220.1 68417.m03909 disease resistance protein (NBS-LRR cla... 30 1.3 At1g53470.1 68414.m06061 mechanosensitive ion channel domain-con... 29 2.9 At3g58760.1 68416.m06549 ankyrin protein kinase, putative simila... 29 3.8 At5g41430.1 68418.m05032 zinc finger (C3HC4-type RING finger) fa... 28 5.1 At3g51520.1 68416.m05642 diacylglycerol acyltransferase family c... 28 5.1 At5g39690.1 68418.m04806 no apical meristem (NAM) protein-relate... 28 6.7 At2g43850.2 68415.m05452 ankyrin protein kinase, putative (APK1)... 28 6.7 At2g43850.1 68415.m05451 ankyrin protein kinase, putative (APK1)... 28 6.7 At2g31760.1 68415.m03878 zinc finger protein-related contains lo... 28 6.7 At2g20330.1 68415.m02374 transducin family protein / WD-40 repea... 27 8.9 At1g74250.1 68414.m08599 DNAJ heat shock N-terminal domain-conta... 27 8.9 >At5g26610.2 68418.m03181 D111/G-patch domain-containing protein contains Pfam PF01585: G-patch domain Length = 301 Score = 30.3 bits (65), Expect = 1.3 Identities = 11/51 (21%), Positives = 25/51 (49%) Frame = +3 Query: 267 EEFINDHIREVKNGFFCEYCNKYISGPTKIRLHILENTHINNKGIRNLERV 419 E+ I ++E++ F+CE C+K + H+ H + K + ++ + Sbjct: 147 EQKIQSDVKEIRKVFYCELCSKQYRTVMEFEGHLSSYDHNHKKRFKEMKEM 197 >At5g26610.1 68418.m03180 D111/G-patch domain-containing protein contains Pfam PF01585: G-patch domain Length = 301 Score = 30.3 bits (65), Expect = 1.3 Identities = 11/51 (21%), Positives = 25/51 (49%) Frame = +3 Query: 267 EEFINDHIREVKNGFFCEYCNKYISGPTKIRLHILENTHINNKGIRNLERV 419 E+ I ++E++ F+CE C+K + H+ H + K + ++ + Sbjct: 147 EQKIQSDVKEIRKVFYCELCSKQYRTVMEFEGHLSSYDHNHKKRFKEMKEM 197 >At4g27220.1 68417.m03909 disease resistance protein (NBS-LRR class), putative domain signature NBS-LRR exists, suggestive of a disease resistance protein. Length = 919 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +3 Query: 279 NDHIREVKNGFFCEYCNKYISGPTKIRLHILENTHINNKGIRNL 410 N H++EV NGF + N I + +R+ L ++ N +R+L Sbjct: 503 NSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSL 546 >At1g53470.1 68414.m06061 mechanosensitive ion channel domain-containing protein / MS ion channel domain-containing protein contains Pfam profile PF00924: Mechanosensitive ion channel Length = 881 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/52 (25%), Positives = 27/52 (51%) Frame = +3 Query: 276 INDHIREVKNGFFCEYCNKYISGPTKIRLHILENTHINNKGIRNLERVGNNI 431 ++ + ++ F +Y + +SGP +I +HI E N+ ++ E VG + Sbjct: 404 MSTYFDRIQESLFTQYVIETLSGPPRIEIHIEEEKVAND--VKTFEIVGRKL 453 >At3g58760.1 68416.m06549 ankyrin protein kinase, putative similar to ankyrin-kinase [Medicago truncatula] gi|18700701|gb|AAL78674 Length = 471 Score = 28.7 bits (61), Expect = 3.8 Identities = 17/60 (28%), Positives = 26/60 (43%) Frame = +3 Query: 300 KNGFFCEYCNKYISGPTKIRLHILENTHINNKGIRNLERVGNNIVAFKNVTIAKAAWHGI 479 KN + K+ + PT +H+L + + I E +N V T KA+W GI Sbjct: 126 KNHDVIKLLEKHGAKPTIAPMHVLTDKEVPEYEIHPTELDFSNSVKISKGTFNKASWRGI 185 >At5g41430.1 68418.m05032 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 161 Score = 28.3 bits (60), Expect = 5.1 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 324 CNKYISGPTKIRLHILENTH 383 CNKYI PT++ L +N+H Sbjct: 33 CNKYIQPPTELALETHQNSH 52 >At3g51520.1 68416.m05642 diacylglycerol acyltransferase family contains Pfam PF03982: Diacylglycerol acyltransferase Length = 314 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/37 (37%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = -3 Query: 402 GCPYY*YACFPKYGALFWWAPICTCY-SIHRRIRF*P 295 G P CF + WW P C Y + R IRF P Sbjct: 209 GSPLVPVFCFGQARVYKWWKPDCDLYLKLSRAIRFTP 245 >At5g39690.1 68418.m04806 no apical meristem (NAM) protein-related contains Pfam PF02365 : No apical meristem (NAM) protein; similar to NAC domain protein NAC2 (GI:21554255) {Arabidopsis thaliana} Length = 294 Score = 27.9 bits (59), Expect = 6.7 Identities = 18/79 (22%), Positives = 31/79 (39%) Frame = +3 Query: 246 LEANGFVEEFINDHIREVKNGFFCEYCNKYISGPTKIRLHILENTHINNKGIRNLERVGN 425 + G + E +N + +V + ++ G K I E ++ +G+ +RVGN Sbjct: 11 ISMGGIMWEGLNSSLIKVDEALLKQQIREFEKGNDKEWFIITERNKVD-QGLSQTKRVGN 69 Query: 426 NIVAFKNVTIAKAAWHGIV 482 K V WH V Sbjct: 70 GAKRQKRVDTNGGYWHATV 88 >At2g43850.2 68415.m05452 ankyrin protein kinase, putative (APK1) similar to ankyrin-kinase [Medicago truncatula] gi|18700701|gb|AAL78674;contains Pfam profile PF00069: Protein kinase domain; contains Pfam profile PF00023: Ankyrin repeat Length = 479 Score = 27.9 bits (59), Expect = 6.7 Identities = 21/61 (34%), Positives = 29/61 (47%) Frame = -1 Query: 557 KEMLLSRNVNLHISKFNIADQAGMSNDSMPSCFGDSHIFESNYIISHSFQVSDALIIDMR 378 K +LL R L IS F + + +S D +HI SNY I+ +V I D+R Sbjct: 323 KNILLDRGGQLKISGFGMIRLSKISQDKAKVANHKAHIDLSNYYIAP--EVYKDEIFDLR 380 Query: 377 V 375 V Sbjct: 381 V 381 >At2g43850.1 68415.m05451 ankyrin protein kinase, putative (APK1) similar to ankyrin-kinase [Medicago truncatula] gi|18700701|gb|AAL78674;contains Pfam profile PF00069: Protein kinase domain; contains Pfam profile PF00023: Ankyrin repeat Length = 479 Score = 27.9 bits (59), Expect = 6.7 Identities = 21/61 (34%), Positives = 29/61 (47%) Frame = -1 Query: 557 KEMLLSRNVNLHISKFNIADQAGMSNDSMPSCFGDSHIFESNYIISHSFQVSDALIIDMR 378 K +LL R L IS F + + +S D +HI SNY I+ +V I D+R Sbjct: 323 KNILLDRGGQLKISGFGMIRLSKISQDKAKVANHKAHIDLSNYYIAP--EVYKDEIFDLR 380 Query: 377 V 375 V Sbjct: 381 V 381 >At2g31760.1 68415.m03878 zinc finger protein-related contains low similarity to zinc finger proteins and Pfam PF01485: IBR domain Length = 514 Score = 27.9 bits (59), Expect = 6.7 Identities = 10/49 (20%), Positives = 21/49 (42%) Frame = +3 Query: 159 HSCCLVCGNYFPTEKDANRHISKKGHKKNLEANGFVEEFINDHIREVKN 305 H C +CG + N ++ H K ++ + + ++R V+N Sbjct: 302 HRFCWICGKSYSDHYACNNYVEDADHDKRTLLQSEIKRYTHYYVRWVEN 350 >At2g20330.1 68415.m02374 transducin family protein / WD-40 repeat family protein similar to Transcriptional repressor rco-1 (SP:P78706) [Neurospora crassa]; similar to TUP1(GB:AF079369); contains 6 WD-40 repeats (PF00400) Length = 648 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +3 Query: 153 KVHSCCLVCGNYFPTEKDANRHISKKGHKKNLEANGFVEE 272 K H C L CG + P K+ S+ G + + N F+ + Sbjct: 275 KGHICGLTCGEWHPRTKETVLTSSEDGSLRIWDVNNFLSQ 314 >At1g74250.1 68414.m08599 DNAJ heat shock N-terminal domain-containing protein contains Pfam domains PF00226: DnaJ domain and PF00096: Zinc finger, C2H2 type Length = 630 Score = 27.5 bits (58), Expect = 8.9 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +3 Query: 168 CLVCGNYFPTEKDANRHISKKGHKKNL 248 C+VC F +EK H K HK+ + Sbjct: 310 CIVCSKKFKSEKQWKNHEQSKKHKEKV 336 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,861,875 Number of Sequences: 28952 Number of extensions: 348271 Number of successful extensions: 1069 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1035 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1069 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1467502800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -