BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0978 (612 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g50690.1 68416.m05546 leucine-rich repeat family protein 83 1e-16 At5g22320.1 68418.m02604 leucine-rich repeat family protein cont... 53 2e-07 At4g39400.1 68417.m05577 brassinosteroid insensitive 1 (BRI1) id... 44 8e-05 At1g78230.1 68414.m09116 leucine-rich repeat family protein 43 1e-04 At4g03260.1 68417.m00445 leucine-rich repeat family protein cont... 43 2e-04 At1g15740.1 68414.m01888 leucine-rich repeat family protein 42 4e-04 At2g34680.1 68415.m04260 leucine-rich repeat family protein cont... 40 0.002 At1g51820.1 68414.m05841 leucine-rich repeat protein kinase, put... 39 0.003 At3g21340.1 68416.m02695 leucine-rich repeat protein kinase, put... 38 0.004 At1g51810.1 68414.m05839 leucine-rich repeat protein kinase, put... 38 0.004 At1g48540.2 68414.m05428 leucine-rich repeat family protein 38 0.004 At1g48540.1 68414.m05427 leucine-rich repeat family protein 38 0.004 At1g07560.1 68414.m00809 leucine-rich repeat protein kinase, put... 38 0.007 At3g46330.1 68416.m05017 leucine-rich repeat protein kinase, put... 37 0.009 At2g04300.1 68415.m00422 leucine-rich repeat protein kinase, put... 37 0.009 At1g51890.1 68414.m05849 leucine-rich repeat protein kinase, put... 37 0.009 At5g19680.1 68418.m02341 leucine-rich repeat family protein cont... 37 0.012 At4g19050.1 68417.m02806 mob1/phocein family protein contains Pf... 37 0.012 At5g59680.1 68418.m07482 leucine-rich repeat protein kinase, put... 36 0.016 At5g48940.1 68418.m06054 leucine-rich repeat transmembrane prote... 36 0.016 At2g14440.1 68415.m01616 leucine-rich repeat protein kinase, put... 36 0.016 At4g18760.1 68417.m02772 leucine-rich repeat family protein cont... 36 0.021 At4g29990.1 68417.m04266 light repressible receptor protein kina... 36 0.028 At2g27060.1 68415.m03251 leucine-rich repeat transmembrane prote... 36 0.028 At2g25790.1 68415.m03095 leucine-rich repeat transmembrane prote... 36 0.028 At1g65380.1 68414.m07417 receptor-like protein CLAVATA2 (CLV2) i... 36 0.028 At5g56040.1 68418.m06992 leucine-rich repeat protein kinase, put... 35 0.037 At4g20790.1 68417.m03018 leucine-rich repeat family protein cont... 35 0.037 At2g36570.1 68415.m04485 leucine-rich repeat transmembrane prote... 35 0.037 At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, put... 35 0.049 At2g19230.1 68415.m02245 leucine-rich repeat protein kinase, put... 35 0.049 At2g19210.1 68415.m02241 leucine-rich repeat protein kinase, put... 35 0.049 At5g51380.1 68418.m06370 F-box family protein contains Pfam PF00... 34 0.065 At1g51850.1 68414.m05845 leucine-rich repeat protein kinase, put... 34 0.065 At1g27170.1 68414.m03310 disease resistance protein (TIR-NBS-LRR... 34 0.065 At3g56370.1 68416.m06269 leucine-rich repeat transmembrane prote... 34 0.085 At2g26380.1 68415.m03166 disease resistance protein-related / LR... 34 0.085 At1g27180.1 68414.m03311 disease resistance protein (TIR-NBS-LRR... 34 0.085 At1g14390.1 68414.m01706 leucine-rich repeat transmembrane prote... 34 0.085 At3g17920.1 68416.m02282 leucine-rich repeat family protein cont... 33 0.11 At1g72840.1 68414.m08425 disease resistance protein (TIR-NBS-LRR... 33 0.11 At5g59650.1 68418.m07479 leucine-rich repeat protein kinase, put... 33 0.15 At3g23120.1 68416.m02914 leucine-rich repeat family protein cont... 33 0.15 At3g07040.1 68416.m00836 disease resistance protein RPM1 (CC-NBS... 33 0.15 At1g09760.1 68414.m01095 U2 small nuclear ribonucleoprotein A, p... 33 0.15 At4g28490.1 68417.m04076 leucine-rich repeat transmembrane prote... 33 0.20 At4g26540.1 68417.m03823 protein kinase family protein Three fal... 33 0.20 At4g20450.1 68417.m02984 leucine-rich repeat protein kinase, put... 33 0.20 At1g47890.1 68414.m05333 disease resistance family protein conta... 33 0.20 At5g01890.1 68418.m00108 leucine-rich repeat transmembrane prote... 32 0.26 At1g07550.1 68414.m00808 leucine-rich repeat protein kinase, put... 32 0.26 At5g06940.1 68418.m00784 leucine-rich repeat family protein cont... 32 0.34 At1g66150.1 68414.m07508 leucine-rich repeat protein kinase, put... 32 0.34 At1g49100.1 68414.m05505 leucine-rich repeat protein kinase, put... 32 0.34 At5g59670.1 68418.m07481 leucine-rich repeat protein kinase, put... 31 0.46 At1g17230.1 68414.m02099 leucine-rich repeat family protein / pr... 31 0.46 At5g18350.1 68418.m02159 disease resistance protein (TIR-NBS-LRR... 31 0.60 At2g14510.1 68415.m01624 leucine-rich repeat protein kinase, put... 31 0.60 At2g01950.1 68415.m00130 leucine-rich repeat transmembrane prote... 31 0.60 At1g51800.1 68414.m05837 leucine-rich repeat protein kinase, put... 31 0.60 At5g40100.1 68418.m04864 disease resistance protein (TIR-NBS-LRR... 31 0.80 At5g06820.1 68418.m00771 leucine-rich repeat transmembrane prote... 31 0.80 At1g78980.1 68414.m09209 leucine-rich repeat transmembrane prote... 31 0.80 At1g74170.1 68414.m08590 leucine-rich repeat family protein cont... 31 0.80 At5g45240.1 68418.m05552 disease resistance protein (TIR-NBS-LRR... 30 1.1 At4g28650.1 68417.m04095 leucine-rich repeat transmembrane prote... 30 1.1 At3g23010.1 68416.m02901 disease resistance family protein / LRR... 30 1.1 At2g24230.1 68415.m02894 leucine-rich repeat transmembrane prote... 30 1.1 At1g51860.1 68414.m05846 leucine-rich repeat protein kinase, put... 30 1.1 At5g58150.1 68418.m07278 leucine-rich repeat transmembrane prote... 30 1.4 At4g35470.1 68417.m05041 leucine-rich repeat family protein simi... 30 1.4 At2g32660.1 68415.m03992 disease resistance family protein / LRR... 30 1.4 At2g23950.1 68415.m02860 leucine-rich repeat family protein / pr... 30 1.4 At1g72180.1 68414.m08346 leucine-rich repeat transmembrane prote... 30 1.4 At1g09970.2 68414.m01124 leucine-rich repeat transmembrane prote... 30 1.4 At1g09970.1 68414.m01123 leucine-rich repeat transmembrane prote... 30 1.4 At4g29180.1 68417.m04175 leucine-rich repeat protein kinase, put... 29 1.8 At4g12010.1 68417.m01911 disease resistance protein (TIR-NBS-LRR... 29 1.8 At3g03770.1 68416.m00383 leucine-rich repeat transmembrane prote... 29 1.8 At3g63130.1 68416.m07090 RAN GTPase activating protein 1 (RanGAP... 29 2.4 At3g44670.1 68416.m04804 disease resistance protein RPP1-Ws[A,C]... 29 2.4 At3g05370.1 68416.m00586 disease resistance family protein conta... 29 2.4 At2g17440.1 68415.m02012 leucine-rich repeat family protein cont... 29 2.4 At5g65710.1 68418.m08270 leucine-rich repeat transmembrane prote... 29 3.2 At3g02130.1 68416.m00180 leucine-rich repeat transmembrane prote... 29 3.2 At1g17750.1 68414.m02197 leucine-rich repeat transmembrane prote... 29 3.2 At1g12280.1 68414.m01420 disease resistance protein (CC-NBS-LRR ... 29 3.2 At3g23110.1 68416.m02913 disease resistance family protein conta... 28 4.2 At2g41820.1 68415.m05168 leucine-rich repeat transmembrane prote... 28 4.2 At5g50450.1 68418.m06247 zinc finger (MYND type) family protein ... 28 5.6 At5g44950.1 68418.m05513 F-box family protein contains F-box dom... 28 5.6 At4g36180.1 68417.m05148 leucine-rich repeat family protein cont... 28 5.6 At3g12610.1 68416.m01570 DNA-damage-repair/toleration protein, p... 28 5.6 At1g65070.1 68414.m07377 DNA mismatch repair MutS family protein... 28 5.6 At5g06860.1 68418.m00776 polygalacturonase inhibiting protein 1 ... 27 7.4 At4g26090.1 68417.m03756 disease resistance protein RPS2 (CC-NBS... 27 7.4 At3g44400.1 68416.m04770 disease resistance protein (TIR-NBS-LRR... 27 7.4 At3g19700.1 68416.m02495 leucine-rich repeat transmembrane prote... 27 7.4 At3g11250.1 68416.m01368 60S acidic ribosomal protein P0 (RPP0C)... 27 7.4 At3g09200.1 68416.m01094 60S acidic ribosomal protein P0 (RPP0B)... 27 7.4 At1g71400.1 68414.m08246 disease resistance family protein / LRR... 27 7.4 At1g71390.1 68414.m08243 disease resistance family protein / LRR... 27 7.4 At5g45210.1 68418.m05549 disease resistance protein (TIR-NBS-LRR... 27 9.8 At5g44700.1 68418.m05477 leucine-rich repeat transmembrane prote... 27 9.8 At4g34220.1 68417.m04862 leucine-rich repeat transmembrane prote... 27 9.8 At4g20140.1 68417.m02947 leucine-rich repeat transmembrane prote... 27 9.8 At3g51560.1 68416.m05646 disease resistance protein (TIR-NBS-LRR... 27 9.8 At3g15410.1 68416.m01955 leucine-rich repeat family protein cont... 27 9.8 At2g25490.1 68415.m03052 F-box family protein (FBL6) contains si... 27 9.8 At1g72300.1 68414.m08358 leucine-rich repeat transmembrane prote... 27 9.8 At1g54480.1 68414.m06214 leucine-rich repeat family protein cont... 27 9.8 >At3g50690.1 68416.m05546 leucine-rich repeat family protein Length = 447 Score = 83.0 bits (196), Expect = 1e-16 Identities = 48/112 (42%), Positives = 70/112 (62%), Gaps = 2/112 (1%) Frame = +1 Query: 190 DEYTNLQILSLNNVGLTTLKGFPTLPMLRKLELSDNRISNGLTFL--SGCKKLAHLNLSG 363 +++ NLQ LS+ N+G+++L+ FP L L+KL LSDNRI+ GL FL +G L+LS Sbjct: 45 EKFQNLQHLSVANIGVSSLEQFPRLGNLQKLILSDNRITVGLEFLVEAGLDSFCDLDLSN 104 Query: 364 NKIKDLETLKPLEAXXXXXXXXXXXXXVTSIEDYKSKVFAMHPSLKYLDGFD 519 N+I+ +E L PL A VT ++DY+S+VF + +LKYLD D Sbjct: 105 NRIQFVEDLAPL-AELKLVSLDLYECPVTRLKDYRSRVFGLIKTLKYLDKTD 155 >At5g22320.1 68418.m02604 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 452 Score = 52.8 bits (121), Expect = 2e-07 Identities = 39/146 (26%), Positives = 71/146 (48%), Gaps = 3/146 (2%) Frame = +1 Query: 94 KRIILERRGRDPSQVKELNLDNCRSTNIVGLTDEYTNLQILSLNNVGLTTLKGFPTLPML 273 ++++ E++ DP VKELNL + T++ L+ ++ NL+ L L LT L+G + L Sbjct: 7 EQVLKEKKTNDPDSVKELNLGHKALTDVSCLS-KFKNLEKLDLRFNNLTDLQGLKSCVNL 65 Query: 274 RKLELSDNRISNGLTFLSGCKKLAHLNLSGNKIK---DLETLKPLEAXXXXXXXXXXXXX 444 + L + +N++ + L + KL LN NK+K ++ +L L A Sbjct: 66 KWLSVVENKLQS-LNGIEALTKLTVLNAGKNKLKSMNEISSLVNLRALILNDNEISSICK 124 Query: 445 VTSIEDYKSKVFAMHPSLKYLDGFDK 522 + ++D S V + +P + D K Sbjct: 125 LDLLKDLNSLVLSRNPISEIGDSLSK 150 >At4g39400.1 68417.m05577 brassinosteroid insensitive 1 (BRI1) identical to GI:2392895 Length = 1196 Score = 44.0 bits (99), Expect = 8e-05 Identities = 25/82 (30%), Positives = 44/82 (53%), Gaps = 2/82 (2%) Frame = +1 Query: 133 QVKELNLDNCRSTNIVG--LTDEYTNLQILSLNNVGLTTLKGFPTLPMLRKLELSDNRIS 306 +V +L+ ++ N+VG L+D L+ L+++ ++ L L++S N S Sbjct: 176 EVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFS 235 Query: 307 NGLTFLSGCKKLAHLNLSGNKI 372 G+ FL C L HL++SGNK+ Sbjct: 236 TGIPFLGDCSALQHLDISGNKL 257 >At1g78230.1 68414.m09116 leucine-rich repeat family protein Length = 676 Score = 43.2 bits (97), Expect = 1e-04 Identities = 26/65 (40%), Positives = 37/65 (56%) Frame = +1 Query: 205 LQILSLNNVGLTTLKGFPTLPMLRKLELSDNRISNGLTFLSGCKKLAHLNLSGNKIKDLE 384 L L+L+ ++ ++G L LR L+LS NRIS LS C + L L+GNKI ++E Sbjct: 470 LHALNLSKNKISVIEGLRDLTRLRVLDLSYNRISRIGQGLSNCTLIKELYLAGNKISNVE 529 Query: 385 TLKPL 399 L L Sbjct: 530 GLHRL 534 Score = 32.3 bits (70), Expect = 0.26 Identities = 21/63 (33%), Positives = 34/63 (53%) Frame = +1 Query: 211 ILSLNNVGLTTLKGFPTLPMLRKLELSDNRISNGLTFLSGCKKLAHLNLSGNKIKDLETL 390 + ++++GL + L+ ++LS+N I +T S K L LNLS NKI +E L Sbjct: 428 VAHISSIGLKAIPSISHFTSLKSIDLSNNFIVQ-ITPASLPKGLHALNLSKNKISVIEGL 486 Query: 391 KPL 399 + L Sbjct: 487 RDL 489 >At4g03260.1 68417.m00445 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 677 Score = 42.7 bits (96), Expect = 2e-04 Identities = 25/65 (38%), Positives = 36/65 (55%) Frame = +1 Query: 205 LQILSLNNVGLTTLKGFPTLPMLRKLELSDNRISNGLTFLSGCKKLAHLNLSGNKIKDLE 384 L L+L+ ++ ++G L LR L+LS NRI L+ C L L L+GNKI ++E Sbjct: 443 LHALNLSKNSISVIEGLRELTRLRVLDLSYNRILRLGHGLASCSSLKELYLAGNKISEIE 502 Query: 385 TLKPL 399 L L Sbjct: 503 GLHRL 507 >At1g15740.1 68414.m01888 leucine-rich repeat family protein Length = 585 Score = 41.5 bits (93), Expect = 4e-04 Identities = 30/79 (37%), Positives = 40/79 (50%), Gaps = 2/79 (2%) Frame = +1 Query: 148 NLDNCRSTNIVGLTD-EYTNLQILSLNNVGLTTLKGFPTLPMLRKLELSDNRI-SNGLTF 321 N+ N ++ GLT E NL + + GL L G + L+ LELSD + SNGL Sbjct: 345 NITNSCLVHLKGLTKLESLNLDSCRIGDEGLVHLSG---MLELKSLELSDTEVGSNGLRH 401 Query: 322 LSGCKKLAHLNLSGNKIKD 378 LSG L +NLS + D Sbjct: 402 LSGLSNLESINLSFTVVTD 420 Score = 33.9 bits (74), Expect = 0.085 Identities = 35/118 (29%), Positives = 57/118 (48%), Gaps = 5/118 (4%) Frame = +1 Query: 40 LANLKLFKVLIGIFMNMEKRIILERRGRDPSQVKELNLDNCR--STNIVGLTD--EYTNL 207 L NLK+ + + N+ ++ +G ++++ LNLD+CR +V L+ E +L Sbjct: 333 LINLKILNLGMN---NITNSCLVHLKGL--TKLESLNLDSCRIGDEGLVHLSGMLELKSL 387 Query: 208 QILSLNNVGLTTLKGFPTLPMLRKLELSDNRISN-GLTFLSGCKKLAHLNLSGNKIKD 378 + LS VG L+ L L + LS +++ GL LSG L LNL + D Sbjct: 388 E-LSDTEVGSNGLRHLSGLSNLESINLSFTVVTDSGLRKLSGLTSLRTLNLDARHVTD 444 >At2g34680.1 68415.m04260 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560; identical to cDNA hypothetical protein (AIR9) mRNA, partial cds GI:3695020 Length = 1661 Score = 39.5 bits (88), Expect = 0.002 Identities = 25/67 (37%), Positives = 36/67 (53%), Gaps = 1/67 (1%) Frame = +1 Query: 202 NLQILSLNNVGLTTLKGFPTLPMLRKLELSDNRISN-GLTFLSGCKKLAHLNLSGNKIKD 378 NL+ + L + L+TL+G L ++ L+LS N G L CK L L L+GN+I Sbjct: 293 NLEFVYLRDNLLSTLEGIEILNRVKVLDLSFNDFKGPGFEPLENCKMLQQLYLAGNQITS 352 Query: 379 LETLKPL 399 L +L L Sbjct: 353 LASLPQL 359 Score = 32.7 bits (71), Expect = 0.20 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = +1 Query: 205 LQILSLNNVGLTTLKGFPTLPMLRKLELSDN 297 LQ+L+ + +TTLK FP LP+L L + +N Sbjct: 383 LQVLAASKNKITTLKDFPYLPVLEHLRVEEN 413 >At1g51820.1 68414.m05841 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase GI:1321686 from (Arabidopsis thaliana); contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 885 Score = 38.7 bits (86), Expect = 0.003 Identities = 29/86 (33%), Positives = 46/86 (53%), Gaps = 3/86 (3%) Frame = +1 Query: 124 DPSQVKELNLD--NCRSTNIVGLTDEYTNLQILSLNNVGLTTLKGFPTLPMLRKLELSDN 297 DP K+L D NC++++I T+L + S G+ T + L L+ L+LSDN Sbjct: 379 DPCVPKQLLWDGLNCKNSDI-STPPIITSLDLSSSGLTGIIT-QAIKNLTHLQILDLSDN 436 Query: 298 RISNGLT-FLSGCKKLAHLNLSGNKI 372 ++ + FL+ K L +NLSGN + Sbjct: 437 NLTGEVPEFLADIKSLLVINLSGNNL 462 >At3g21340.1 68416.m02695 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 880 Score = 38.3 bits (85), Expect = 0.004 Identities = 26/83 (31%), Positives = 43/83 (51%), Gaps = 2/83 (2%) Frame = +1 Query: 124 DPSQVKELNLDNCRSTNIVGLTDEY-TNLQILSLNNVGLTTLKGFPTLPMLRKLELSDNR 300 DP K+ + N+ T T+L + S + G+ +G L L++L+LS+N Sbjct: 391 DPCVPKQFLWEGLNCNNLDNSTPPIVTSLNLSSSHLTGIIA-QGIQNLTHLQELDLSNNN 449 Query: 301 ISNGLT-FLSGCKKLAHLNLSGN 366 ++ G+ FL+ K L +NLSGN Sbjct: 450 LTGGIPEFLADIKSLLVINLSGN 472 >At1g51810.1 68414.m05839 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase GI:1321686 from (Arabidopsis thaliana); contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 843 Score = 38.3 bits (85), Expect = 0.004 Identities = 30/94 (31%), Positives = 45/94 (47%), Gaps = 1/94 (1%) Frame = +1 Query: 124 DPSQVKELNLDNCRSTNIVGLTDEYTNLQILSLNNVGLTTLKGFPTLPMLRKLELSDNRI 303 DP K+ D N +D+ T I S G+ L L L++L+LS+N + Sbjct: 369 DPCVPKKFLWDGLNCNN----SDDSTPPIITSFGLTGIIVLT-IQNLANLQELDLSNNNL 423 Query: 304 SNGLT-FLSGCKKLAHLNLSGNKIKDLETLKPLE 402 S G+ FL+ K L +NLSGN + + K +E Sbjct: 424 SGGVPEFLADMKSLLVINLSGNNLSGVVPQKLIE 457 >At1g48540.2 68414.m05428 leucine-rich repeat family protein Length = 1051 Score = 38.3 bits (85), Expect = 0.004 Identities = 29/83 (34%), Positives = 42/83 (50%), Gaps = 2/83 (2%) Frame = +1 Query: 130 SQVKELNLDNCRSTNIVGLTDEYTNLQILSLNNVGLTTLKGFPTLPMLRKLELSDNRISN 309 +++K L+L + L+ +L L L N LTTL+G L L+ L++S N ISN Sbjct: 213 TKLKHLDLGFNHLRTVSYLSQVSCHLVKLVLRNNALTTLRGIENLKSLQGLDVSYNIISN 272 Query: 310 --GLTFLSGCKKLAHLNLSGNKI 372 L FL +L L L GN + Sbjct: 273 FSELEFLWSLSQLKELWLEGNPV 295 >At1g48540.1 68414.m05427 leucine-rich repeat family protein Length = 1063 Score = 38.3 bits (85), Expect = 0.004 Identities = 29/83 (34%), Positives = 42/83 (50%), Gaps = 2/83 (2%) Frame = +1 Query: 130 SQVKELNLDNCRSTNIVGLTDEYTNLQILSLNNVGLTTLKGFPTLPMLRKLELSDNRISN 309 +++K L+L + L+ +L L L N LTTL+G L L+ L++S N ISN Sbjct: 213 TKLKHLDLGFNHLRTVSYLSQVSCHLVKLVLRNNALTTLRGIENLKSLQGLDVSYNIISN 272 Query: 310 --GLTFLSGCKKLAHLNLSGNKI 372 L FL +L L L GN + Sbjct: 273 FSELEFLWSLSQLKELWLEGNPV 295 >At1g07560.1 68414.m00809 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 856 Score = 37.5 bits (83), Expect = 0.007 Identities = 27/73 (36%), Positives = 40/73 (54%), Gaps = 9/73 (12%) Frame = +1 Query: 181 GLTDEYTNLQI------LSLNNVGLTTL--KGFPTLPMLRKLELSDNRISNGLT-FLSGC 333 GLT EYTN+ L L++ LT + L L+KL+ S+N ++ G+ FL+ Sbjct: 400 GLTCEYTNMSTPPRIHSLDLSSSELTGIIVPEIQNLTELKKLDFSNNNLTGGVPEFLAKM 459 Query: 334 KKLAHLNLSGNKI 372 K L +NLSGN + Sbjct: 460 KSLLVINLSGNNL 472 >At3g46330.1 68416.m05017 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 878 Score = 37.1 bits (82), Expect = 0.009 Identities = 30/86 (34%), Positives = 43/86 (50%), Gaps = 3/86 (3%) Frame = +1 Query: 124 DPSQVKELNLD--NCRSTNIVGLTDEYTNLQILSLNNVGLTTLKGFPTLPMLRKLELSDN 297 DP K+ D NC T+I +L LS + + T + F L L L+LS+N Sbjct: 389 DPCVPKQFLWDGLNCNITDI-SAPPRIISLN-LSSSGLSGTIVSNFQNLAHLESLDLSNN 446 Query: 298 RISNGLT-FLSGCKKLAHLNLSGNKI 372 +S + FL+ K L +NLSGNK+ Sbjct: 447 SLSGIVPEFLATMKSLLVINLSGNKL 472 >At2g04300.1 68415.m00422 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 851 Score = 37.1 bits (82), Expect = 0.009 Identities = 26/85 (30%), Positives = 39/85 (45%), Gaps = 2/85 (2%) Frame = +1 Query: 124 DPSQVKELNLDNCRSTN-IVGLTDEYTNLQILSLNNVGLTTLKGFPTLPMLRKLELSDNR 300 DP K D N + T L + S + G+ L L+ L+LS+N Sbjct: 351 DPCVPKRFMWDGLNCNNSYISTPPTITFLNLSSSHLTGIIA-SAIQNLTHLQNLDLSNNN 409 Query: 301 ISNGLT-FLSGCKKLAHLNLSGNKI 372 ++ G+ FL+G K L +NLSGN + Sbjct: 410 LTGGVPEFLAGLKSLLVINLSGNNL 434 >At1g51890.1 68414.m05849 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 888 Score = 37.1 bits (82), Expect = 0.009 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = +1 Query: 202 NLQILSLNNVGLTTLKGFPTLPMLRKLELSDNRISNGLTFL-SGCKKLAHLNLSGNK 369 +++ LS +N+ T L LR+L+LS+N +S + F+ S K L +NLSGNK Sbjct: 401 SIRNLSGSNLSGTITSDISKLTHLRELDLSNNDLSGDIPFVFSDMKNLTLINLSGNK 457 >At5g19680.1 68418.m02341 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 328 Score = 36.7 bits (81), Expect = 0.012 Identities = 32/123 (26%), Positives = 58/123 (47%), Gaps = 3/123 (2%) Frame = +1 Query: 25 LRNNLLA---NLKLFKVLIGIFMNMEKRIILERRGRDPSQVKELNLDNCRSTNIVGLTDE 195 LR+N LA ++ +F L+ ++ + LE + S +KEL + I+ + + Sbjct: 94 LRDNKLAKVPDVSIFTKLLVYDISFNEITSLEGISKASSTLKELYVSKNEVNKIMEI-EH 152 Query: 196 YTNLQILSLNNVGLTTLKGFPTLPMLRKLELSDNRISNGLTFLSGCKKLAHLNLSGNKIK 375 NLQIL L + L ++ L +L L NRI + L G K + ++L N++ Sbjct: 153 LHNLQILELGSNRLRVMENLENFTKLEELWLGRNRIK--VVNLCGLKCIKKISLQSNRLT 210 Query: 376 DLE 384 ++ Sbjct: 211 SMK 213 >At4g19050.1 68417.m02806 mob1/phocein family protein contains Pfam PF03637: Mob1/phocein family; contains Pfam F00560: Leucine Rich Repeats; contains TIGRFAMS profile TIGR01612: reticulocyte binding protein; hypothetical protein YIL106w, Saccharomyces cerevisiae, PIR2:S48466 Length = 1405 Score = 36.7 bits (81), Expect = 0.012 Identities = 30/95 (31%), Positives = 48/95 (50%), Gaps = 5/95 (5%) Frame = +1 Query: 130 SQVKELNLDNCRSTNIVGLTDEYTNLQILSLNN-VGLTTLKG-FPTLPMLRKLELSDNRI 303 S +KEL + C + ++ TNL+I ++ L T++G F L L K+ LS+ + Sbjct: 772 SNLKELIIRKCSKLKTLPNLEKLTNLEIFDVSGCTELETIEGSFENLSCLHKVNLSETNL 831 Query: 304 S---NGLTFLSGCKKLAHLNLSGNKIKDLETLKPL 399 N ++ LS K+L N S K+K L L+ L Sbjct: 832 GELPNKISELSNLKELILRNCS--KLKALPNLEKL 864 >At5g59680.1 68418.m07482 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 882 Score = 36.3 bits (80), Expect = 0.016 Identities = 26/73 (35%), Positives = 35/73 (47%), Gaps = 1/73 (1%) Frame = +1 Query: 157 NCRSTNIVGLTDEYTNLQILSLNNVGLTTLKGFPTLPMLRKLELSDNRISNGLT-FLSGC 333 NC T+I T L + S G T L L KL+LS+N ++ + FLS Sbjct: 400 NCSITDIT-TPPRITTLNLSSSGLTGTITA-AIQNLTTLEKLDLSNNNLTGEVPEFLSNM 457 Query: 334 KKLAHLNLSGNKI 372 K L +NLSGN + Sbjct: 458 KSLLVINLSGNDL 470 >At5g48940.1 68418.m06054 leucine-rich repeat transmembrane protein kinase, putative Length = 1135 Score = 36.3 bits (80), Expect = 0.016 Identities = 34/104 (32%), Positives = 52/104 (50%), Gaps = 13/104 (12%) Frame = +1 Query: 97 RIILERR---GRDPSQV---KELNLDNCRSTNIVG-LTDEYTNLQILSLN-NVGLTTLKG 252 R+IL + G PS + L L + S NI G + +E ++Q L + N+ +L G Sbjct: 567 RLILSKNSFNGEIPSSLGHCTNLQLLDLSSNNISGTIPEELFDIQDLDIALNLSWNSLDG 626 Query: 253 F-----PTLPMLRKLELSDNRISNGLTFLSGCKKLAHLNLSGNK 369 F L L L++S N +S L+ LSG + L LN+S N+ Sbjct: 627 FIPERISALNRLSVLDISHNMLSGDLSALSGLENLVSLNISHNR 670 Score = 31.5 bits (68), Expect = 0.46 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +1 Query: 247 KGFPTLPMLRKLELSDNRISNGLTF-LSGCKKLAHLNLSGNKIK 375 KG L L L+LS+N +S + +S C++L LNLS N ++ Sbjct: 485 KGIGFLQNLSFLDLSENNLSGPVPLEISNCRQLQMLNLSNNTLQ 528 >At2g14440.1 68415.m01616 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 886 Score = 36.3 bits (80), Expect = 0.016 Identities = 26/87 (29%), Positives = 47/87 (54%), Gaps = 4/87 (4%) Frame = +1 Query: 127 PSQVKELNLDNCRSTNIVGLT-DEYTNLQILSLNNVGLTTL--KGFPTLPMLRKLELSDN 297 P ++ L+L + T ++ + T L+ L L+N LT + L MLR+L+LS+N Sbjct: 411 PPRIISLDLSSSGLTGVITPSIQNLTMLRELDLSNNNLTGVIPPSLQNLTMLRELDLSNN 470 Query: 298 RISNGL-TFLSGCKKLAHLNLSGNKIK 375 ++ + FL+ K L ++L GN ++ Sbjct: 471 NLTGEVPEFLATIKPLLVIHLRGNNLR 497 >At4g18760.1 68417.m02772 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611 Length = 431 Score = 35.9 bits (79), Expect = 0.021 Identities = 28/83 (33%), Positives = 45/83 (54%), Gaps = 4/83 (4%) Frame = +1 Query: 130 SQVKELNLD-NCRSTNIVGLTDEYTNLQILSLNNVGLT--TLKGFPTLPMLRKLELSDNR 300 S +K LNL N S +I + +L+ LSL++ L+ ++P L L+LS N+ Sbjct: 236 SNLKSLNLSKNTISGDIPDSIGDLISLKNLSLSSNKLSGPIPDSISSIPELTHLDLSGNQ 295 Query: 301 ISNGLT-FLSGCKKLAHLNLSGN 366 ++ + F+S K L HLNL+ N Sbjct: 296 LNGTIPRFISKMKYLTHLNLANN 318 Score = 30.3 bits (65), Expect = 1.1 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 214 LSLNNVGLTTLKGFPTLPMLRKLELSDNRISNGLT-FLSGCKKLAHLNLSGNKI 372 LS N + L L+ L LS N++S + +S +L HL+LSGN++ Sbjct: 243 LSKNTISGDIPDSIGDLISLKNLSLSSNKLSGPIPDSISSIPELTHLDLSGNQL 296 >At4g29990.1 68417.m04266 light repressible receptor protein kinase identical to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376 Length = 876 Score = 35.5 bits (78), Expect = 0.028 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 3/66 (4%) Frame = +1 Query: 214 LSLNNVGLTTL--KGFPTLPMLRKLELSDNRISNGLT-FLSGCKKLAHLNLSGNKIKDLE 384 L+L++ GLT F L + KL+LS+N ++ + FL+ L LNL GNK+ Sbjct: 414 LNLSSSGLTGQIDPAFANLTSINKLDLSNNSLTGKVPDFLASLPNLTELNLEGNKLTGSI 473 Query: 385 TLKPLE 402 K LE Sbjct: 474 PAKLLE 479 >At2g27060.1 68415.m03251 leucine-rich repeat transmembrane protein kinase, putative Length = 1007 Score = 35.5 bits (78), Expect = 0.028 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 3/79 (3%) Frame = +1 Query: 139 KELNLDNCRSTNIVGLTDEYTNLQILSLNNVGLTTLKGFPTLPMLRKLE---LSDNRISN 309 K L+ D C N G+T + + LN GL FP + LR L+ +++N+ S Sbjct: 36 KALSSDRC-PLNWYGVTCSSGGVTSIDLNGFGLLGSFSFPVIVGLRMLQNLSIANNQFSG 94 Query: 310 GLTFLSGCKKLAHLNLSGN 366 L+ + L +L++SGN Sbjct: 95 TLSNIGSLTSLKYLDVSGN 113 >At2g25790.1 68415.m03095 leucine-rich repeat transmembrane protein kinase, putative Length = 960 Score = 35.5 bits (78), Expect = 0.028 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Frame = +1 Query: 214 LSLNNVGLTTLKGFPTLPMLRKLELSDNRISNGL-TFLSGCKKLAHLNLSGN 366 LS N + +G T P + L+LS+N I+ + LS CK L +L+LS N Sbjct: 485 LSRNKISGVVPQGLMTFPEIMDLDLSENEITGVIPRELSSCKNLVNLDLSHN 536 Score = 34.3 bits (75), Expect = 0.065 Identities = 27/76 (35%), Positives = 38/76 (50%), Gaps = 3/76 (3%) Frame = +1 Query: 154 DNCRSTNIVGLTDEYTNLQILSL--NNVGLTTLKGFPTLPMLRKLELSDNRISNGL-TFL 324 DN S I L + +L+IL L NN+ +G +LP L+ L+L NR S G+ L Sbjct: 298 DNSLSGEIPELVAQMQSLEILHLFSNNLTGKIPEGVTSLPRLKVLQLWSNRFSGGIPANL 357 Query: 325 SGCKKLAHLNLSGNKI 372 L L+LS N + Sbjct: 358 GKHNNLTVLDLSTNNL 373 >At1g65380.1 68414.m07417 receptor-like protein CLAVATA2 (CLV2) identical to receptor-like protein CLAVATA2 [Arabidopsis thaliana] gi|6049566|gb|AAF02654contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; Length = 720 Score = 35.5 bits (78), Expect = 0.028 Identities = 30/81 (37%), Positives = 43/81 (53%), Gaps = 4/81 (4%) Frame = +1 Query: 136 VKELNLDNCRSTNIVG-LTDEYTNLQILSL-NNVGLTTLKGF-PTLPMLRKLELSDNRIS 306 +K L N S N+ G L D L +L+L +N TL F + P L L +++N + Sbjct: 194 LKSLKYLNLESNNMTGTLRDFQQPLVVLNLASNQFSGTLPCFYASRPSLSILNIAENSLV 253 Query: 307 NGL-TFLSGCKKLAHLNLSGN 366 GL + L K+L+HLNLS N Sbjct: 254 GGLPSCLGSLKELSHLNLSFN 274 >At5g56040.1 68418.m06992 leucine-rich repeat protein kinase, putative contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 953 Score = 35.1 bits (77), Expect = 0.037 Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = +1 Query: 247 KGFPTLPMLRKLELSDNRISNGLTF-LSGCKKLAHLNLSGNKI 372 + F LP L++L+LS N++S + L+ C KL HL + N+I Sbjct: 331 RSFGNLPNLQELQLSVNQLSGTIPEELANCTKLTHLEIDNNQI 373 >At4g20790.1 68417.m03018 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560; Length = 518 Score = 35.1 bits (77), Expect = 0.037 Identities = 29/82 (35%), Positives = 38/82 (46%), Gaps = 11/82 (13%) Frame = +1 Query: 193 EYTNLQILSLNNVGLTTLKGFPT----LPMLRKLELSDNRISNGLTF--LSGCKKLAHLN 354 +Y L ++ + V + GFPT +R L+LS N+ S + LSG L HLN Sbjct: 117 KYCPLTVVDIELVNNSLTNGFPTNVLSCAQIRTLDLSYNQFSGFVPVQDLSGLPNLTHLN 176 Query: 355 L-----SGNKIKDLETLKPLEA 405 L S NKI D E K A Sbjct: 177 LSYNRFSENKISDSEFFKRFNA 198 >At2g36570.1 68415.m04485 leucine-rich repeat transmembrane protein kinase, putative Length = 672 Score = 35.1 bits (77), Expect = 0.037 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = +1 Query: 214 LSLNNVGLT-TLKGFPTLPMLRKLELSDNRISNGLTFLSGCKKLAHLNLSGNKI 372 LSL ++ L L +L LR L+L DNR++ ++ L+ CK L + L+GN + Sbjct: 70 LSLPSLSLRGPLTSLSSLDQLRLLDLHDNRLNGTVSPLTNCKNLRLVYLAGNDL 123 >At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 884 Score = 34.7 bits (76), Expect = 0.049 Identities = 23/84 (27%), Positives = 44/84 (52%), Gaps = 1/84 (1%) Frame = +1 Query: 124 DPSQVKELNLDNCRSTNIVGLTDEYTNLQILSLNNVGLTTLKGFPTLPMLRKLELSDNRI 303 DP ++L+ ++ R T + G T LS + + + + L++L+LS+N + Sbjct: 382 DPCLPQDLSWESIRCTYVDGSTSPTIISLDLSKSGLNGSIPQILQNFTQLQELDLSNNSL 441 Query: 304 SNGLT-FLSGCKKLAHLNLSGNKI 372 + + FL+ K L+ +NLSGN + Sbjct: 442 TGPVPIFLANMKTLSLINLSGNNL 465 >At2g19230.1 68415.m02245 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 877 Score = 34.7 bits (76), Expect = 0.049 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Frame = +1 Query: 253 FPTLPMLRKLELSDNRISNGLT-FLSGCKKLAHLNLSGNKIKDLETLKPLE 402 F TL L+KL+LS+NR++ + FL+ L LNL NK+ + K LE Sbjct: 434 FITLTPLQKLDLSNNRLTGTVPDFLANLPDLTELNLEENKLTGILPEKLLE 484 >At2g19210.1 68415.m02241 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 881 Score = 34.7 bits (76), Expect = 0.049 Identities = 25/83 (30%), Positives = 41/83 (49%), Gaps = 3/83 (3%) Frame = +1 Query: 163 RSTNIVGLTDEYTNLQILSLNNVGLTTL--KGFPTLPMLRKLELSDNRISNGLT-FLSGC 333 + N + +E + ++L++ GLT F L +L L+LS+N ++ + FL Sbjct: 401 KDINCSYVDNESPRIISVNLSSSGLTGEIDAAFSNLTLLHILDLSNNSLTGKIPDFLGNL 460 Query: 334 KKLAHLNLSGNKIKDLETLKPLE 402 L LNL GNK+ +K LE Sbjct: 461 HNLTELNLEGNKLSGAIPVKLLE 483 >At5g51380.1 68418.m06370 F-box family protein contains Pfam PF00646: F-box domain; similar to F-box protein FBL2 (GI:6063090) [Homo sapiens] Length = 479 Score = 34.3 bits (75), Expect = 0.065 Identities = 28/91 (30%), Positives = 44/91 (48%), Gaps = 9/91 (9%) Frame = +1 Query: 118 GRDPSQVKELNLDNCRSTNIVGLTDEYTNLQILSLNNVGLTTLKGFPTLPMLRKLELS-- 291 GR + +L + N ++ L ++ ++LQ L L+ L+G LR L L Sbjct: 183 GRGSFDLIKLVVINATELGLLSLAEDCSDLQELELHKCSDNLLRGIAACENLRGLRLVGS 242 Query: 292 -----DNRISN-GLTFLS-GCKKLAHLNLSG 363 + +S+ GLT L+ GCK+L L LSG Sbjct: 243 VDGLYSSSVSDIGLTILAQGCKRLVKLELSG 273 >At1g51850.1 68414.m05845 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376 Length = 865 Score = 34.3 bits (75), Expect = 0.065 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 3/56 (5%) Frame = +1 Query: 214 LSLNNVGLT--TLKGFPTLPMLRKLELSDNRISNGLT-FLSGCKKLAHLNLSGNKI 372 L L++ GLT + L L++L+LSDN ++ + FL K L +NLSGN + Sbjct: 387 LDLSSSGLTGSITQAIQNLTNLQELDLSDNNLTGEIPDFLGDIKSLLVINLSGNNL 442 >At1g27170.1 68414.m03310 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1544 Score = 34.3 bits (75), Expect = 0.065 Identities = 39/132 (29%), Positives = 61/132 (46%), Gaps = 8/132 (6%) Frame = +1 Query: 31 NNLLANLKLFKVLIGIFMN--MEKRIILERRGRDPSQVKELNLDNCRSTNIVGLTDEYTN 204 + L ++ K+L +F++ + ++ E G S +KEL LD N+ + N Sbjct: 891 SEFLVDVSGLKLLEKLFLSGCSDLSVLPENIGAMTS-LKELLLDGTAIKNLPESINRLQN 949 Query: 205 LQILSLNNVGLTTLK-GFPTLPMLRKLELSDNRISNGLTFLSGCKKLAHLNL----SGNK 369 L+ILSL + L TL L KL L D + N + + K L L+L S +K Sbjct: 950 LEILSLRGCKIQELPLCIGTLKSLEKLYLDDTALKNLPSSIGDLKNLQDLHLVRCTSLSK 1009 Query: 370 IKD-LETLKPLE 402 I D + LK L+ Sbjct: 1010 IPDSINELKSLK 1021 Score = 33.9 bits (74), Expect = 0.085 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 6/90 (6%) Frame = +1 Query: 127 PSQVKELNLDNCRSTNIVGLTDEYTNLQILSLNNVG-LTTLKGFPTLPMLRKLELSDNRI 303 P ++++LNL NC S V E T L L+L N + + G L L++L ++ Sbjct: 1289 PCKLEQLNLANCFSLESVSDLSELTILTDLNLTNCAKVVDIPGLEHLTALKRLYMTGCNS 1348 Query: 304 SNGLTF-----LSGCKKLAHLNLSGNKIKD 378 + L + K + +L+L GN++ D Sbjct: 1349 NYSLAVKKRLSKASLKMMRNLSLPGNRVPD 1378 >At3g56370.1 68416.m06269 leucine-rich repeat transmembrane protein kinase, putative leucine-rich receptor-like protein kinase - Malus domestica, EMBL:AF053127 Length = 964 Score = 33.9 bits (74), Expect = 0.085 Identities = 28/104 (26%), Positives = 53/104 (50%), Gaps = 9/104 (8%) Frame = +1 Query: 82 MNMEKRIILERRGRDPSQVKELNLDNCRSTNIVGLTD-----EYTNLQILSLNNVGLTTL 246 +N++ + R GR Q++ L+ + + N+ G+ + NL+++ L++ GL+ Sbjct: 74 LNLDGFSLSGRIGRGLLQLQFLHKLSLSNNNLTGIINPNMLLSLVNLKVVDLSSNGLSGS 133 Query: 247 ---KGFPTLPMLRKLELSDNRISNGLTF-LSGCKKLAHLNLSGN 366 + F LR L L+ N+++ + +S C LA LNLS N Sbjct: 134 LPDEFFRQCGSLRVLSLAKNKLTGKIPVSISSCSSLAALNLSSN 177 >At2g26380.1 68415.m03166 disease resistance protein-related / LRR protein-related contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-2A [Lycopersicon pimpinellifolium] gi|3894389|gb|AAC78594 Length = 480 Score = 33.9 bits (74), Expect = 0.085 Identities = 18/39 (46%), Positives = 25/39 (64%), Gaps = 2/39 (5%) Frame = +1 Query: 280 LELSDNRISNG-LTFLSGCKKLAHLNLSGNKIK-DLETL 390 ++LSDN IS L FL G ++L +SGNK++ DL L Sbjct: 375 IDLSDNEISGSPLRFLKGAEQLREFRMSGNKLRFDLRKL 413 >At1g27180.1 68414.m03311 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1556 Score = 33.9 bits (74), Expect = 0.085 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 6/90 (6%) Frame = +1 Query: 127 PSQVKELNLDNCRSTNIVGLTDEYTNLQILSLNNVG-LTTLKGFPTLPMLRKLELSDNRI 303 P ++++LNL NC S V E T L L+L N + + G L L++L ++ Sbjct: 1303 PCKLEQLNLANCFSLESVSDLSELTILTDLNLTNCAKVVDIPGLEHLTALKRLYMTGCNS 1362 Query: 304 SNGLTF-----LSGCKKLAHLNLSGNKIKD 378 + L + K + +L+L GN++ D Sbjct: 1363 NYSLAVKKRLSKASLKMMRNLSLPGNRVPD 1392 >At1g14390.1 68414.m01706 leucine-rich repeat transmembrane protein kinase, putative similar to putative receptor-like protein kinase GI:2947063 from [Arabidopsis thaliana] Length = 747 Score = 33.9 bits (74), Expect = 0.085 Identities = 22/68 (32%), Positives = 33/68 (48%) Frame = +1 Query: 169 TNIVGLTDEYTNLQILSLNNVGLTTLKGFPTLPMLRKLELSDNRISNGLTFLSGCKKLAH 348 + I+ L+ +L LS N + K +L LR L L++N + + L G L Sbjct: 125 SQIIRLSSSLQSLN-LSSNFISGNIPKEISSLKNLRSLVLANNLFNGSVPDLRGLSNLQE 183 Query: 349 LNLSGNKI 372 LNL GNK+ Sbjct: 184 LNLGGNKL 191 >At3g17920.1 68416.m02282 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 962 Score = 33.5 bits (73), Expect = 0.11 Identities = 35/109 (32%), Positives = 51/109 (46%), Gaps = 10/109 (9%) Frame = +1 Query: 76 IFMNMEKRIILERRGRDPSQVKELNLDNCRSTNIVGLTD-EYTNLQILS-LNNVG----- 234 + M+ +++ D S+ K +DN R N + D + L+ +S L+ VG Sbjct: 181 VLMDESLQLLPAVESLDLSRNKFAKVDNLRRCNKLKHLDLGFNQLRKISHLSEVGKFRNN 240 Query: 235 -LTTLKGFPTLPMLRKLELSDNRIS--NGLTFLSGCKKLAHLNLSGNKI 372 LTTL+G L L L++S N IS + L FL L L L GN I Sbjct: 241 ALTTLRGIENLKSLEGLDVSFNLISDFSELEFLGSLSFLTDLWLEGNPI 289 Score = 29.9 bits (64), Expect = 1.4 Identities = 15/43 (34%), Positives = 25/43 (58%) Frame = +1 Query: 262 LPMLRKLELSDNRISNGLTFLSGCKKLAHLNLSGNKIKDLETL 390 LP + L+LS N+ + + L C KL HL+L N+++ + L Sbjct: 190 LPAVESLDLSRNKFAK-VDNLRRCNKLKHLDLGFNQLRKISHL 231 >At1g72840.1 68414.m08425 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1183 Score = 33.5 bits (73), Expect = 0.11 Identities = 28/100 (28%), Positives = 53/100 (53%), Gaps = 13/100 (13%) Frame = +1 Query: 106 LERRGRDPSQVKELNLDNCRSTNIVGLTDEYTNLQILSLNNVGLTTLKGFPT----LPML 273 +E+ +++ EL+L+NC+S +V L++E ++ L+ ++ + PT L + Sbjct: 907 VEKSAPGRNELLELSLENCKS--LVSLSEELSHFTKLTYLDLSSLEFRRIPTSIRELSFM 964 Query: 274 RKLELSD-NRISN------GLTFL--SGCKKLAHLNLSGN 366 R L L++ N+I + L +L GC+ L H+N S N Sbjct: 965 RTLYLNNCNKIFSLTDLPESLKYLYAHGCESLEHVNFSSN 1004 >At5g59650.1 68418.m07479 leucine-rich repeat protein kinase, putative contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 892 Score = 33.1 bits (72), Expect = 0.15 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 3/56 (5%) Frame = +1 Query: 214 LSLNNVGLTTL--KGFPTLPMLRKLELSDNRISNGLT-FLSGCKKLAHLNLSGNKI 372 L+L++ GLT + L L KL+LS+N ++ + FL+ K L +NLSGN + Sbjct: 424 LNLSSSGLTGIIAAAIQNLTHLEKLDLSNNTLTGVVPEFLAQMKSLVIINLSGNNL 479 >At3g23120.1 68416.m02914 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-5b GB:AAC78595 [Lycopersicon esculentum] (Plant Cell 10, 1915-1926 (1998); Length = 784 Score = 33.1 bits (72), Expect = 0.15 Identities = 29/81 (35%), Positives = 39/81 (48%), Gaps = 6/81 (7%) Frame = +1 Query: 154 DNCRSTNIVGLTDEYTNLQILSLNNVGLTTLKGF-PTL----PMLRKLELSDNRISNGLT 318 DN + +I T+ L+L N +L GF P L MLR L++S N L Sbjct: 408 DNRFTGSIPQCLKNSTDFNTLNLRN---NSLSGFLPELCMDSTMLRSLDVSYNNFVGKLP 464 Query: 319 -FLSGCKKLAHLNLSGNKIKD 378 L C+ + LN+ GNKIKD Sbjct: 465 KSLMNCQDMEFLNVRGNKIKD 485 >At3g07040.1 68416.m00836 disease resistance protein RPM1 (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Identical to RPM1 (gi:1361985) Length = 926 Score = 33.1 bits (72), Expect = 0.15 Identities = 21/61 (34%), Positives = 33/61 (54%) Frame = +1 Query: 199 TNLQILSLNNVGLTTLKGFPTLPMLRKLELSDNRISNGLTFLSGCKKLAHLNLSGNKIKD 378 TNL L + + ++ P+L +LR L+L D+ IS L L +LNLS ++K+ Sbjct: 559 TNLHSLLVCSSAKHKMELLPSLNLLRALDLEDSSISKLPDCLVTMFNLKYLNLSKTQVKE 618 Query: 379 L 381 L Sbjct: 619 L 619 >At1g09760.1 68414.m01095 U2 small nuclear ribonucleoprotein A, putative identical to U2 small nuclear ribonucleoprotein A' (U2 snRNP-A') [Arabidopsis thaliana] SWISS-PROT:P43333; supported by cDNA:gi_16649064_gb_AY059902.1_ Length = 249 Score = 33.1 bits (72), Expect = 0.15 Identities = 31/125 (24%), Positives = 53/125 (42%), Gaps = 1/125 (0%) Frame = +1 Query: 139 KELNLDNCRSTNIVGLTDEYTNLQILSLNNVGLTTLKGFPTLPMLRKLELSDNRISNGLT 318 +EL+L + I L + L++ + L+ FP L L L +++NRI+ Sbjct: 22 RELDLRGNKIPVIENLGATEDQFDTIDLSDNEIVKLENFPYLNRLGTLLINNNRITRINP 81 Query: 319 FLSG-CKKLAHLNLSGNKIKDLETLKPLEAXXXXXXXXXXXXXVTSIEDYKSKVFAMHPS 495 L KL L L+ N++ +L + PL + +T +Y+ V S Sbjct: 82 NLGEFLPKLHSLVLTNNRLVNLVEIDPLASIPKLQYLSLLDNNITKKANYRLYVIHKLKS 141 Query: 496 LKYLD 510 L+ LD Sbjct: 142 LRVLD 146 >At4g28490.1 68417.m04076 leucine-rich repeat transmembrane protein kinase, putative Length = 999 Score = 32.7 bits (71), Expect = 0.20 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 1/68 (1%) Frame = +1 Query: 169 TNIVGLTDEYTNLQILSLNNVGLTTLKGFPTLPMLRKLELSDNRISNGL-TFLSGCKKLA 345 +N +G T ++ LS N + GF LP L LELSDN + + + G K L+ Sbjct: 396 SNNLGKCKSLTRVR-LSNNKLSGQIPHGFWGLPRLSLLELSDNSFTGSIPKTIIGAKNLS 454 Query: 346 HLNLSGNK 369 +L +S N+ Sbjct: 455 NLRISKNR 462 >At4g26540.1 68417.m03823 protein kinase family protein Three false introns were added with non-consensus splice sites to circumenvent frameshifts likely due to sequencing errors; this is extremely unusual and is under investigation. Length = 1089 Score = 32.7 bits (71), Expect = 0.20 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = +1 Query: 199 TNLQILSLNNVGLT-TLKGFPTLPMLRKLELSDNRISNGLTFLSGCKKLAHLNLSGNKI 372 TNL L LN L ++ L L +++S+NR+ + +SGC+ L L+L N + Sbjct: 454 TNLYRLRLNGNRLAGSIPEIGNLKNLNFVDISENRLVGSIPAISGCESLEFLDLHTNSL 512 Score = 31.5 bits (68), Expect = 0.46 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +1 Query: 238 TTLKGFPTLPMLRKLELSDNRISNGLTF-LSGCKKLAHLNLSGNKI 372 T + F L L++L+LS N+IS + L+ C KL HL + N I Sbjct: 325 TIPRSFGKLENLQELQLSVNQISGTIPEELTNCTKLTHLEIDNNLI 370 >At4g20450.1 68417.m02984 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 898 Score = 32.7 bits (71), Expect = 0.20 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Frame = +1 Query: 214 LSLNNVGL--TTLKGFPTLPMLRKLELSDNRISNGLT-FLSGCKKLAHLNLSGNKI 372 + +N GL T L L+KL+LS+N ++ + FL+ K L +NLSGN + Sbjct: 435 IDFSNFGLNGTITSDIQYLNQLQKLDLSNNNLTGKVPEFLAKMKLLTFINLSGNNL 490 >At1g47890.1 68414.m05333 disease resistance family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 1019 Score = 32.7 bits (71), Expect = 0.20 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +1 Query: 253 FPTLPMLRKLELSDNRISNGLT-FLSGCKKLAHLNLSGNKIKDL 381 F LR L++S NR+ L L+GC L LN+ N+I D+ Sbjct: 680 FMNATKLRSLDVSHNRMEGKLPGSLTGCSSLEVLNVGSNRINDM 723 >At5g01890.1 68418.m00108 leucine-rich repeat transmembrane protein kinase, putative leucine-rich receptor-like protein (LRPKm1) - Malus domestica, EMBL:AF053127 Length = 967 Score = 32.3 bits (70), Expect = 0.26 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 8/77 (10%) Frame = +1 Query: 166 STNIVG-LTDEYTNLQILSLNNVGLTTLKG------FPTLPMLRKLELSDNRISNGLTF- 321 + N+ G L E+ +L L + + L G F LR + L++N+++ + Sbjct: 101 NNNLTGTLNPEFPHLGSLQVVDFSGNNLSGRIPDGFFEQCGSLRSVSLANNKLTGSIPVS 160 Query: 322 LSGCKKLAHLNLSGNKI 372 LS C L HLNLS N++ Sbjct: 161 LSYCSTLTHLNLSSNQL 177 >At1g07550.1 68414.m00808 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 864 Score = 32.3 bits (70), Expect = 0.26 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = +1 Query: 214 LSLNNVGLTTL--KGFPTLPMLRKLELSDNRISNGLT-FLSGCKKLAHLNLSGNKIKDL 381 L L++ GL + L L++L+LS N ++ + FL+ K L +NLSGNK+ L Sbjct: 415 LDLSSSGLNGVIPPSIQNLTQLQELDLSQNNLTGKVPEFLAKMKYLLVINLSGNKLSGL 473 >At5g06940.1 68418.m00784 leucine-rich repeat family protein contains protein kinase domain, Pfam:PF00069; contains leucine-rich repeats, Pfam:PF00560 Length = 872 Score = 31.9 bits (69), Expect = 0.34 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +1 Query: 265 PMLRKLELSDNRISNGLTFLSGCKKLAHLNLSGN 366 P+L + +S NR+ + L CKKL L+L+GN Sbjct: 413 PVLSIVNISHNRLLGKIPELKNCKKLVSLSLAGN 446 >At1g66150.1 68414.m07508 leucine-rich repeat protein kinase, putative (TMK1) identical to protein kinase TMK1 gi|166888|gb|AAA32876, SP|P43298 Putative receptor protein kinase TMK1 precursor (EC 2.7.1.-) {Arabidopsis thaliana} Length = 942 Score = 31.9 bits (69), Expect = 0.34 Identities = 30/100 (30%), Positives = 42/100 (42%), Gaps = 1/100 (1%) Frame = +1 Query: 85 NMEKRIILERRGRDPSQVKELNLDNCRSTNIVGL-TDEYTNLQILSLNNVGLTTLKGFPT 261 ++ + L++ PS + D C+ T+IV T T +QI G T Sbjct: 28 DLSAMLSLKKSLNPPSSFGWSDPDPCKWTHIVCTGTKRVTRIQIGHSGLQG-TLSPDLRN 86 Query: 262 LPMLRKLELSDNRISNGLTFLSGCKKLAHLNLSGNKIKDL 381 L L +LEL N IS + LSG L L LS N + Sbjct: 87 LSELERLELQWNNISGPVPSLSGLASLQVLMLSNNNFDSI 126 >At1g49100.1 68414.m05505 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 888 Score = 31.9 bits (69), Expect = 0.34 Identities = 20/57 (35%), Positives = 34/57 (59%), Gaps = 3/57 (5%) Frame = +1 Query: 205 LQILSLNNVGLTTL--KGFPTLPMLRKLELSDNRISNGLT-FLSGCKKLAHLNLSGN 366 + L+L++ GLT + L L++L+LS+N ++ + FL+ K L +NLSGN Sbjct: 415 ITFLNLSSSGLTGIISPSIQNLTHLQELDLSNNDLTGDVPEFLADIKSLLIINLSGN 471 >At5g59670.1 68418.m07481 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 868 Score = 31.5 bits (68), Expect = 0.46 Identities = 26/86 (30%), Positives = 42/86 (48%), Gaps = 3/86 (3%) Frame = +1 Query: 124 DPSQVKELNLD--NCRSTNIVGLTDEYTNLQILSLNNVGLTTLKGFPTLPMLRKLELSDN 297 DP ++L D +C + NI T+L LS + + T ++ L L+LS N Sbjct: 387 DPCFPQQLRWDALDCTNRNI-SQPPRITSLN-LSSSRLNGTIAAAIQSITQLETLDLSYN 444 Query: 298 RISNGLT-FLSGCKKLAHLNLSGNKI 372 ++ + FL K L+ +NLSGN + Sbjct: 445 NLTGEVPEFLGKMKSLSVINLSGNNL 470 >At1g17230.1 68414.m02099 leucine-rich repeat family protein / protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains leucine-rich repeats, Pfam:PF00560 Length = 1133 Score = 31.5 bits (68), Expect = 0.46 Identities = 28/88 (31%), Positives = 42/88 (47%), Gaps = 5/88 (5%) Frame = +1 Query: 124 DPSQVKELNLD-NCRSTNIVGLTDEYTNLQI---LSLNNVGLTTLKGFPTLPMLRKLELS 291 D +++ EL L N S NI + T+LQI +S NN+ T L ML L L+ Sbjct: 593 DLTRLMELQLGGNLLSENIPVELGKLTSLQISLNISHNNLSGTIPDSLGNLQMLEILYLN 652 Query: 292 DNRISNGL-TFLSGCKKLAHLNLSGNKI 372 DN++S + + L N+S N + Sbjct: 653 DNKLSGEIPASIGNLMSLLICNISNNNL 680 >At5g18350.1 68418.m02159 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1193 Score = 31.1 bits (67), Expect = 0.60 Identities = 30/117 (25%), Positives = 57/117 (48%), Gaps = 12/117 (10%) Frame = +1 Query: 79 FMNMEKRIILERRGRDPSQVKELNLDNCRSTNIVGLTDEYTNLQILSLNNVGLTTLKGFP 258 ++N+E L+ + VKEL+L N N+ ++ L L ++ LK FP Sbjct: 782 YINLEDCTQLKMFPEISTNVKELDLRNTAIENVPSSICSWSCLYRLDMSEC--RNLKEFP 839 Query: 259 TLPM-LRKLELSDNRISNGLTFLS-----------GCKKLAHLNLSGNKIKDLETLK 393 +P+ + +L+LS I +++ GCK+L ++ + +K+K+LE L+ Sbjct: 840 NVPVSIVELDLSKTEIEEVPSWIENLLLLRTLTMVGCKRLNIISPNISKLKNLEDLE 896 >At2g14510.1 68415.m01624 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 868 Score = 31.1 bits (67), Expect = 0.60 Identities = 20/72 (27%), Positives = 39/72 (54%), Gaps = 2/72 (2%) Frame = +1 Query: 166 STNIVGLTDEYTNLQI-LSLNNVGLTTLKGFPTLPMLRKLELSDNRISNGL-TFLSGCKK 339 S N++ ++ + + LSL+ + L MLR+L+LS+N ++ + FL+ K Sbjct: 401 SCNVIDISTPPRIISLDLSLSGLTGVISPSIQNLTMLRELDLSNNNLTGEVPEFLATIKP 460 Query: 340 LAHLNLSGNKIK 375 L ++L GN ++ Sbjct: 461 LLVIHLRGNNLR 472 >At2g01950.1 68415.m00130 leucine-rich repeat transmembrane protein kinase, putative similar to brassinosteroid insensitive protein Length = 1143 Score = 31.1 bits (67), Expect = 0.60 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 4/72 (5%) Frame = +1 Query: 169 TNIVGLTDEYTNLQILSLNNVGLTTLKGFPTLPMLRKLELSDNRIS---NGLTF-LSGCK 336 +N++ +T Y N N++ L++ K L+ L+LS N I+ +GLT LS C Sbjct: 152 SNLISITLSYNNFTGKLPNDLFLSSKK-------LQTLDLSYNNITGPISGLTIPLSSCV 204 Query: 337 KLAHLNLSGNKI 372 + +L+ SGN I Sbjct: 205 SMTYLDFSGNSI 216 >At1g51800.1 68414.m05837 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 894 Score = 31.1 bits (67), Expect = 0.60 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 3/70 (4%) Frame = +1 Query: 172 NIVGLTDEYTNLQILSLNNVGLT--TLKGFPTLPMLRKLELSDNRISNGLT-FLSGCKKL 342 N + +E + L L+ GLT L+ L L L+LS+N ++ + FL+ + L Sbjct: 399 NCTYVDNETPKIISLDLSTSGLTGEILEFISDLTSLEVLDLSNNSLTGSVPEFLANMETL 458 Query: 343 AHLNLSGNKI 372 +NLSGN++ Sbjct: 459 KLINLSGNEL 468 >At5g40100.1 68418.m04864 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1017 Score = 30.7 bits (66), Expect = 0.80 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = +1 Query: 241 TLKGFPTLPMLRKLELSDNRISNGLTFLSGCKKLAHLNLSGNKIKDL 381 TL FP +P L++LEL + I + + L +L+LSGN ++L Sbjct: 780 TLHSFPDIPGLKQLELVNLNIQKLSDGIGHFEFLENLDLSGNDFENL 826 >At5g06820.1 68418.m00771 leucine-rich repeat transmembrane protein kinase, putative Length = 735 Score = 30.7 bits (66), Expect = 0.80 Identities = 25/88 (28%), Positives = 44/88 (50%), Gaps = 4/88 (4%) Frame = +1 Query: 130 SQVKELNLDNCRSTNIVGLTDEYTNLQI----LSLNNVGLTTLKGFPTLPMLRKLELSDN 297 + ++ LNL + + +G + ++ LQI LS NN+ F TL L L L +N Sbjct: 141 TSLQSLNLSHNSLSGPLG--NVFSGLQIKEMDLSFNNLTGDLPSSFGTLMNLTSLYLQNN 198 Query: 298 RISNGLTFLSGCKKLAHLNLSGNKIKDL 381 R++ + +L+ LA LN+ N+ + Sbjct: 199 RLTGSVIYLADL-PLADLNIEDNQFSGI 225 >At1g78980.1 68414.m09209 leucine-rich repeat transmembrane protein kinase, putative similar to leucine-rich repeat transmembrane protein kinase 2 GI:3360291 from [Zea mays] Length = 693 Score = 30.7 bits (66), Expect = 0.80 Identities = 26/88 (29%), Positives = 37/88 (42%), Gaps = 6/88 (6%) Frame = +1 Query: 130 SQVKELNLDNCRSTNIVG-LTDEYTNLQILSLNNVGLTTLKG-----FPTLPMLRKLELS 291 SQ+K L N + G L D + L L + L L G F L L+KL L Sbjct: 135 SQMKNLQSINLGQNKLNGELPDMFQKLSKLETLDFSLNKLSGKLPQSFANLTSLKKLHLQ 194 Query: 292 DNRISNGLTFLSGCKKLAHLNLSGNKIK 375 DNR + + L + LN+ N+ + Sbjct: 195 DNRFTGDINVLRNL-AIDDLNVEDNQFE 221 >At1g74170.1 68414.m08590 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 1068 Score = 30.7 bits (66), Expect = 0.80 Identities = 19/63 (30%), Positives = 38/63 (60%), Gaps = 3/63 (4%) Frame = +1 Query: 196 YTNLQILSLNNVGLTTL--KGFPTLPMLRKLELSDNRISNGL-TFLSGCKKLAHLNLSGN 366 +T L ++S++N T KGF +LP L L++S+N+++ + +++ + L L LS N Sbjct: 592 FTRLWVMSMDNNLFTGNIGKGFRSLPSLNVLDISNNKLTGVIPSWIGERQGLFALQLSNN 651 Query: 367 KIK 375 ++ Sbjct: 652 MLE 654 Score = 27.5 bits (58), Expect = 7.4 Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = +1 Query: 280 LELSDNRISNGLT--FLSGCKKLAHLNLSGNKI 372 L+LS NR L FL GC L L LS NK+ Sbjct: 549 LDLSHNRFHGKLPRRFLKGCYNLTILKLSHNKL 581 Score = 27.1 bits (57), Expect = 9.8 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Frame = +1 Query: 214 LSLNNVGLTTLKGFPTLPMLRKLELSDNRISNGLTF-LSGCKKLAHLNLSGNKIKDL 381 LS NN+ L+ F L + L+LS NR+ + L+ LA N+S N + + Sbjct: 878 LSHNNLSGVILESFSGLKNVESLDLSFNRLQGPIPLQLTDMISLAVFNVSYNNLSGI 934 >At5g45240.1 68418.m05552 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 812 Score = 30.3 bits (65), Expect = 1.1 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +1 Query: 136 VKELNLDNCRSTNIVGLTDEYTNLQILSLNN 228 ++E+NL +C++ + TD+ NLQ L L+N Sbjct: 498 LEEINLQDCKNLDTFPDTDQLENLQFLDLSN 528 >At4g28650.1 68417.m04095 leucine-rich repeat transmembrane protein kinase, putative receptor-like protein kinase 5, Arabidopsis thaliana, PIR1:S27756 Length = 1013 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/43 (37%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = +1 Query: 250 GFPTLPMLRKLELSDNRISNGLT-FLSGCKKLAHLNLSGNKIK 375 GF L L++LEL+ NR+S G+ +S L+ ++ S N+I+ Sbjct: 423 GFGKLEKLQRLELAGNRLSGGIPGDISDSVSLSFIDFSRNQIR 465 Score = 29.9 bits (64), Expect = 1.4 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +1 Query: 253 FPTLPMLRKLELSDNRISNGL-TFLSGCKKLAHLNLSGNKI 372 F P L L+LS N ++ + + ++ C+KL LNL N + Sbjct: 496 FQDCPSLSNLDLSSNTLTGTIPSSIASCEKLVSLNLRNNNL 536 >At3g23010.1 68416.m02901 disease resistance family protein / LRR family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 595 Score = 30.3 bits (65), Expect = 1.1 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +1 Query: 271 LRKLELSDNRISNGLT-FLSGCKKLAHLNLSGNKIKD 378 LR L++S N + L L C+++ LN+ GNKI D Sbjct: 287 LRSLDVSSNNLVGKLPKSLINCERIEFLNVKGNKIMD 323 >At2g24230.1 68415.m02894 leucine-rich repeat transmembrane protein kinase, putative Length = 853 Score = 30.3 bits (65), Expect = 1.1 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = +1 Query: 280 LELSDNRISNGLTFLSGCKKLAHLNLSGNK 369 L+LS+N +S + L+ KKL HLNL+ N+ Sbjct: 287 LDLSENELSGVIKNLTLLKKLKHLNLAWNR 316 Score = 29.1 bits (62), Expect = 2.4 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = +1 Query: 214 LSLNNVGLTTLKGFPT-LPMLRKLELSDNRISNGLTFLSGCKKLAHLNLSGNK 369 LS N + + GF + P L L L+ N+I T + K ++ LN+SGN+ Sbjct: 194 LSSNQLEGSLPDGFGSAFPKLETLSLAGNKIHGRDTDFADMKSISFLNISGNQ 246 >At1g51860.1 68414.m05846 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 890 Score = 30.3 bits (65), Expect = 1.1 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +1 Query: 214 LSLNNVGLT--TLKGFPTLPMLRKLELSDNRISNGL-TFLSGCKKLAHLNLSGN 366 L+LN LT L +L L+LS+N +S + TF + K L +NLSGN Sbjct: 416 LNLNGSELTGSITSDISKLTLLTVLDLSNNDLSGDIPTFFAEMKSLKLINLSGN 469 >At5g58150.1 68418.m07278 leucine-rich repeat transmembrane protein kinase, putative Length = 785 Score = 29.9 bits (64), Expect = 1.4 Identities = 28/89 (31%), Positives = 40/89 (44%), Gaps = 6/89 (6%) Frame = +1 Query: 136 VKELNLD-NCRSTNIVGLTDEYTNLQILSLNNVGLTTLKGFP----TLPMLRKLELSDNR 300 +K LNL N +++G+ E LS N L+ P L L+LSDN Sbjct: 212 LKSLNLSRNLFQGSLIGVLHENVETVDLSENRFDGHILQLIPGHKHNWSSLIHLDLSDNS 271 Query: 301 -ISNGLTFLSGCKKLAHLNLSGNKIKDLE 384 + + LS KL HLNL+ N+ + E Sbjct: 272 FVGHIFNGLSSAHKLGHLNLACNRFRAQE 300 >At4g35470.1 68417.m05041 leucine-rich repeat family protein similar to Leucine-rich repeat protein SHOC-2 (Ras-binding protein Sur-8) (SP:Q9UQ13 ){Homo sapiens},PIR:T12704; contains Pfam PF00560: Leucine Rich Repeat domains Length = 549 Score = 29.9 bits (64), Expect = 1.4 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 1/80 (1%) Frame = +1 Query: 145 LNLDNCRSTNIVGLTDEYTNLQILSLNNVGLTTL-KGFPTLPMLRKLELSDNRISNGLTF 321 LNL + + +++ L+ L L+ L L + +L L+KL++ N I Sbjct: 297 LNLGSNQLSSLPSAFSRLVRLEELDLSCNNLPILPESIGSLVSLKKLDVETNDIEEIPYS 356 Query: 322 LSGCKKLAHLNLSGNKIKDL 381 + GC L L NK+K L Sbjct: 357 IGGCSSLIELRADYNKLKAL 376 Score = 29.5 bits (63), Expect = 1.8 Identities = 23/85 (27%), Positives = 36/85 (42%), Gaps = 4/85 (4%) Frame = +1 Query: 139 KELNLDNCRSTNIVGLTDEYTNLQILSLNNVGLTTLKGFPT----LPMLRKLELSDNRIS 306 +E+NL N + + L D L L+ ++ + P L L KL+L NRI Sbjct: 223 QEINLQNKLTEQLEWLPDSLGKLSSLTSLDLSENHIVVLPNTIGGLSSLTKLDLHSNRIG 282 Query: 307 NGLTFLSGCKKLAHLNLSGNKIKDL 381 + L +LNL N++ L Sbjct: 283 QLPESIGELLNLVYLNLGSNQLSSL 307 >At2g32660.1 68415.m03992 disease resistance family protein / LRR family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-4 [Lycopersicon hirsutum] gi|2808683|emb|CAA05268 Length = 589 Score = 29.9 bits (64), Expect = 1.4 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = +1 Query: 262 LPMLRKLELSDNRISNGLTFLSGCKKLAHLNLSGNKIKDLETLKPL 399 +P L L+LS+N ++ + KL +LNL GN + E + P+ Sbjct: 1 MPFLSYLDLSENHLTGSFEISNSSSKLENLNL-GNNHFETEIIDPV 45 Score = 28.7 bits (61), Expect = 3.2 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 3/61 (4%) Frame = +1 Query: 202 NLQILSLNNVGLTTLKGFPTLPMLRKLE---LSDNRISNGLTFLSGCKKLAHLNLSGNKI 372 +L L L+ LT + + + +E LS IS FL KKL +L+LS N+I Sbjct: 75 SLTHLDLHGNSLTLTSVYSDIDFPKNMEILLLSGCNISEFPRFLKSLKKLWYLDLSSNRI 134 Query: 373 K 375 K Sbjct: 135 K 135 >At2g23950.1 68415.m02860 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 634 Score = 29.9 bits (64), Expect = 1.4 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 3/72 (4%) Frame = +1 Query: 166 STNIVGLTDEYTNLQILSL--NNVGLTTLKGFPTLPMLRKLELSDNRISNGLT-FLSGCK 336 S + G TNL+ +SL NN+ +LP L+ L+LS+NR S + ++ Sbjct: 87 SGTLSGSIGNLTNLRQVSLQNNNISGKIPPEICSLPKLQTLDLSNNRFSGEIPGSVNQLS 146 Query: 337 KLAHLNLSGNKI 372 L +L L+ N + Sbjct: 147 NLQYLRLNNNSL 158 Score = 27.9 bits (59), Expect = 5.6 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Frame = +1 Query: 133 QVKELNLDNCR-STNIVGLTDEYTNLQILSLNNVGLT--TLKGFPTLPMLRKLELSDNRI 303 +++ L+L N R S I G ++ +NLQ L LNN L+ +P L L+LS N + Sbjct: 123 KLQTLDLSNNRFSGEIPGSVNQLSNLQYLRLNNNSLSGPFPASLSQIPHLSFLDLSYNNL 182 >At1g72180.1 68414.m08346 leucine-rich repeat transmembrane protein kinase, putative similar to GI:3641252 from [Malus x domestica] (Plant Mol. Biol. 40 (6), 945-957 (1999)) Length = 977 Score = 29.9 bits (64), Expect = 1.4 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 3/78 (3%) Frame = +1 Query: 145 LNLDNCRSTNIVGLTDEYTNLQILSLNNVGLT--TLKGFPTLPMLRKLELSDNRISNGLT 318 L L N S I E +L L +NN L+ ++GF +LP+ + ++LSDN ++ ++ Sbjct: 368 LALQNEFSGEIPRSYGECKSLLRLRINNNRLSGQVVEGFWSLPLAKMIDLSDNELTGEVS 427 Query: 319 FLSGCK-KLAHLNLSGNK 369 G +L+ L L N+ Sbjct: 428 PQIGLSTELSQLILQNNR 445 Score = 27.9 bits (59), Expect = 5.6 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +1 Query: 271 LRKLELSDNRISNGLTFLSGCKKLAHLNLSGN 366 L+ L L+ NR+S + LS K L L++SGN Sbjct: 124 LKVLNLTSNRLSGTIPNLSPLKSLEILDISGN 155 >At1g09970.2 68414.m01124 leucine-rich repeat transmembrane protein kinase, putative Similar to A. thaliana receptor-like protein kinase (gb|RLK5_ARATH). ESTs gb|ATTS0475,gb|ATTS4362 come from this gene isoform contains a TG acceptor site at intron. Length = 977 Score = 29.9 bits (64), Expect = 1.4 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 9/94 (9%) Frame = +1 Query: 118 GRDPSQV---KELNLDNCRSTNIVG-LTDEYTNLQILSLNNVGLTTLKG-----FPTLPM 270 G+ PS + K L+ +S G + D + +LS N+ ++ G +LP Sbjct: 472 GKIPSSIGKLKGLSSLKMQSNGFSGEIPDSIGSCSMLSDVNMAQNSISGEIPHTLGSLPT 531 Query: 271 LRKLELSDNRISNGLTFLSGCKKLAHLNLSGNKI 372 L L LSDN++S + +L+ L+LS N++ Sbjct: 532 LNALNLSDNKLSGRIPESLSSLRLSLLDLSNNRL 565 >At1g09970.1 68414.m01123 leucine-rich repeat transmembrane protein kinase, putative Similar to A. thaliana receptor-like protein kinase (gb|RLK5_ARATH). ESTs gb|ATTS0475,gb|ATTS4362 come from this gene isoform contains a TG acceptor site at intron. Length = 976 Score = 29.9 bits (64), Expect = 1.4 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 9/94 (9%) Frame = +1 Query: 118 GRDPSQV---KELNLDNCRSTNIVG-LTDEYTNLQILSLNNVGLTTLKG-----FPTLPM 270 G+ PS + K L+ +S G + D + +LS N+ ++ G +LP Sbjct: 472 GKIPSSIGKLKGLSSLKMQSNGFSGEIPDSIGSCSMLSDVNMAQNSISGEIPHTLGSLPT 531 Query: 271 LRKLELSDNRISNGLTFLSGCKKLAHLNLSGNKI 372 L L LSDN++S + +L+ L+LS N++ Sbjct: 532 LNALNLSDNKLSGRIPESLSSLRLSLLDLSNNRL 565 >At4g29180.1 68417.m04175 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 911 Score = 29.5 bits (63), Expect = 1.8 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +1 Query: 253 FPTLPMLRKLELSDNRISNGLT-FLSGCKKLAHLNLSGNKI 372 F L +L L+LS+N + + FL+ K L LNL GN + Sbjct: 430 FRNLSLLESLDLSNNNLKGIVPEFLADLKYLKSLNLKGNNL 470 >At4g12010.1 68417.m01911 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1219 Score = 29.5 bits (63), Expect = 1.8 Identities = 30/94 (31%), Positives = 44/94 (46%), Gaps = 12/94 (12%) Frame = +1 Query: 145 LNLDNCRSTNIVGLTDEYTNLQILSLNNVGLTTLKGFPTLPMLRKLELSDNRISNGL--- 315 LNL +C S + + +LQ L L+ G ++LK FP + ++ L D + L Sbjct: 695 LNLRDCTSLRSLPKGIKTQSLQTLILS--GCSSLKKFPLISENVEVLLLDGTVIKSLPES 752 Query: 316 --TF-------LSGCKKLAHLNLSGNKIKDLETL 390 TF L CKKL HL+ K+K L+ L Sbjct: 753 IQTFRRLALLNLKNCKKLKHLSSDLYKLKCLQEL 786 >At3g03770.1 68416.m00383 leucine-rich repeat transmembrane protein kinase, putative may contain C-terminal ser/thr protein kinase domain, similar to serine/threonine protein kinase Pto GB:AAB47421 [Lycopersicon esculentum] Length = 802 Score = 29.5 bits (63), Expect = 1.8 Identities = 26/78 (33%), Positives = 36/78 (46%), Gaps = 2/78 (2%) Frame = +1 Query: 154 DNCRSTNIVGLTDEYTNLQILSLN-NVGLTTL-KGFPTLPMLRKLELSDNRISNGLTFLS 327 +N S + D +L +LSL NV +L +L LR L L++NR + L LS Sbjct: 162 ENMFSGELPDWIDSLPSLAVLSLRKNVLNGSLPSSLSSLSGLRVLALANNRFNGALPDLS 221 Query: 328 GCKKLAHLNLSGNKIKDL 381 L L+L GN L Sbjct: 222 HLTNLQVLDLEGNSFGPL 239 >At3g63130.1 68416.m07090 RAN GTPase activating protein 1 (RanGAP1) contains Pfam PF00560: Leucine Rich Repeat domains; identical to RAN GTPase activating protein 1 (GI:6708466)[Arabidopsis thaliana] Length = 535 Score = 29.1 bits (62), Expect = 2.4 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 5/79 (6%) Frame = +1 Query: 169 TNIVGLTDEYTNLQILSLNNVGLTTLKGFPTLPMLRKLELSDNRISNGLTF-LSGC---- 333 T++ + Y NL+ + LK P+L +L EL+ N I+ T L+ C Sbjct: 349 THLTEIYMSYLNLEDEGTEALSEALLKSAPSLEVL---ELAGNDITVKSTGNLAACIASK 405 Query: 334 KKLAHLNLSGNKIKDLETL 390 + LA LNLS N++KD T+ Sbjct: 406 QSLAKLNLSENELKDEGTI 424 >At3g44670.1 68416.m04804 disease resistance protein RPP1-Ws[A,C]-like (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Closest Col-0 homolog to both RPP1 Ws-A and RPP1 Ws-C Length = 872 Score = 29.1 bits (62), Expect = 2.4 Identities = 25/80 (31%), Positives = 37/80 (46%), Gaps = 2/80 (2%) Frame = +1 Query: 130 SQVKELNLDNCRSTNIVGLTDEYTNLQILSLNNVG-LTTLKGFPTLPMLRKLELSDNRIS 306 ++++EL L+NC S + + NLQ LSL N + L L+KL+L + Sbjct: 439 TKLEELYLENCSSLEKLPPSINANNLQQLSLINCSRVVELPAIENATNLQKLDLGNCSSL 498 Query: 307 NGLTFLSG-CKKLAHLNLSG 363 L G L LN+SG Sbjct: 499 IELPLSIGTATNLKELNISG 518 >At3g05370.1 68416.m00586 disease resistance family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2 disease resistance protein GB:AAC15780 from [Lycopersicon pimpinellifolium] Length = 860 Score = 29.1 bits (62), Expect = 2.4 Identities = 25/74 (33%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Frame = +1 Query: 160 CRSTNIVGLTDEYTNLQILSLNNVGLTTLKGFPTLPMLRKLELSDNRISNGLT-FLSGCK 336 C S+ +V LTD IL N++ F L L++S N++ L L CK Sbjct: 488 CLSSFMVSLTD-----LILRNNSLSGPLPDIFVNATKLLSLDVSRNKLDGVLPKSLIHCK 542 Query: 337 KLAHLNLSGNKIKD 378 + LN+ NKIKD Sbjct: 543 AMQLLNVRSNKIKD 556 >At2g17440.1 68415.m02012 leucine-rich repeat family protein contains Pfam PF00560: Leucine Rich Repeats Length = 526 Score = 29.1 bits (62), Expect = 2.4 Identities = 24/85 (28%), Positives = 36/85 (42%), Gaps = 4/85 (4%) Frame = +1 Query: 139 KELNLDNCRSTNIVGLTDEYTNLQILSLNNVGLTTLKGFPT----LPMLRKLELSDNRIS 306 +ELNL + + L D L L ++ + P L L +L+L NRI Sbjct: 207 QELNLQHRLMDQLEWLPDSLGKLSSLVRLDLSENCIMVLPATIGGLISLTRLDLHSNRIG 266 Query: 307 NGLTFLSGCKKLAHLNLSGNKIKDL 381 + L +LNLSGN++ L Sbjct: 267 QLPESIGDLLNLVNLNLSGNQLSSL 291 >At5g65710.1 68418.m08270 leucine-rich repeat transmembrane protein kinase, putative Length = 993 Score = 28.7 bits (61), Expect = 3.2 Identities = 24/90 (26%), Positives = 48/90 (53%), Gaps = 3/90 (3%) Frame = +1 Query: 115 RGRDPSQVKELNLDNCRSTNIVGLTDEYTNLQILSLN-NVGLTTLKG-FPTLPMLRKLEL 288 + R SQ+ E++ +N V L D +L+++ L+ N L ++ L L ++E+ Sbjct: 457 KARHLSQL-EISANNFSGVIPVKLCD-LRDLRVIDLSRNSFLGSIPSCINKLKNLERVEM 514 Query: 289 SDNRISNGL-TFLSGCKKLAHLNLSGNKIK 375 +N + + + +S C +L LNLS N+++ Sbjct: 515 QENMLDGEIPSSVSSCTELTELNLSNNRLR 544 >At3g02130.1 68416.m00180 leucine-rich repeat transmembrane protein kinase, putative contains Pfam profile: Eukaryotic protein kinase domain Length = 985 Score = 28.7 bits (61), Expect = 3.2 Identities = 29/81 (35%), Positives = 38/81 (46%), Gaps = 4/81 (4%) Frame = +1 Query: 136 VKELNLD-NCRSTNIVGLTDEYTNLQILSLNNVGLT-TLKGFPTLPMLRKLELSDNRISN 309 ++ +NL N S I T L+IL+L L T+ GF + R L L N + Sbjct: 28 LRVMNLGFNRVSGEIPNSLQNLTKLEILNLGGNKLNGTVPGF--VGRFRVLHLPLNWLQG 85 Query: 310 GLTFLSG--CKKLAHLNLSGN 366 L G C KL HL+LSGN Sbjct: 86 SLPKDIGDSCGKLEHLDLSGN 106 >At1g17750.1 68414.m02197 leucine-rich repeat transmembrane protein kinase, putative similar to receptor-like protein kinase INRPK1 GI:1684913 from [Ipomoea nil] Length = 1088 Score = 28.7 bits (61), Expect = 3.2 Identities = 26/73 (35%), Positives = 35/73 (47%), Gaps = 3/73 (4%) Frame = +1 Query: 157 NCRSTNIVGLTDEYTNLQILSLNNVGL--TTLKGFPTLPMLRKLELSDNRISNGLTF-LS 327 N S I L + L+ L+LNN L + L L +L +S+N + L F S Sbjct: 182 NNLSGTIPELLGNCSKLEYLALNNNKLNGSLPASLYLLENLGELFVSNNSLGGRLHFGSS 241 Query: 328 GCKKLAHLNLSGN 366 CKKL L+LS N Sbjct: 242 NCKKLVSLDLSFN 254 >At1g12280.1 68414.m01420 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 894 Score = 28.7 bits (61), Expect = 3.2 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 1/67 (1%) Frame = +1 Query: 178 VGLTDEYTNLQILSLNNVG-LTTLKGFPTLPMLRKLELSDNRISNGLTFLSGCKKLAHLN 354 VGL E L+ L L+ + L ++ G + LRKL+L +++S ++ + + L HL Sbjct: 604 VGL-QELKKLRYLRLDYMKRLKSISGISNISSLRKLQLLQSKMSLDMSLVEELQLLEHLE 662 Query: 355 LSGNKIK 375 + IK Sbjct: 663 VLNISIK 669 >At3g23110.1 68416.m02913 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 835 Score = 28.3 bits (60), Expect = 4.2 Identities = 16/39 (41%), Positives = 26/39 (66%), Gaps = 2/39 (5%) Frame = +1 Query: 268 MLRKLELSDNRISNGL--TFLSGCKKLAHLNLSGNKIKD 378 ML L++S N + L +F++ C+ + +LN+ GNKIKD Sbjct: 498 MLGSLDVSLNNLVGKLPESFIN-CEWMEYLNVRGNKIKD 535 >At2g41820.1 68415.m05168 leucine-rich repeat transmembrane protein kinase, putative Length = 890 Score = 28.3 bits (60), Expect = 4.2 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 280 LELSDNRISNGLTFLSGCKKLAHLNLSGN 366 L+LS ++ +T +S + L HL+LSGN Sbjct: 68 LDLSGLQLRGNVTLISDLRSLKHLDLSGN 96 >At5g50450.1 68418.m06247 zinc finger (MYND type) family protein contains Pfam profile PF01753: MYND finger Length = 336 Score = 27.9 bits (59), Expect = 5.6 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +1 Query: 262 LPMLRKLELSDNRISNGLTFLSGCKKLAHLNL 357 + +LRKL S + S+ LT LS CK+L L L Sbjct: 31 ISILRKLATSASSPSDFLTVLSTCKRLNRLGL 62 >At5g44950.1 68418.m05513 F-box family protein contains F-box domain Pfam:PF00646 Length = 438 Score = 27.9 bits (59), Expect = 5.6 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = +1 Query: 214 LSLNNVGLTTLKGFPTLPMLRKLELSDNRISNGL--TFLSGCKKLAHLNLSGN 366 L L NVGL T K +LP L+ + L D S + +SGC L L + N Sbjct: 136 LKLVNVGLDTPKFVVSLPCLKIMHLEDIFYSPLIAENLISGCPVLEDLTIVRN 188 >At4g36180.1 68417.m05148 leucine-rich repeat family protein contains protein kinase domain, Pfam:PF00069; contains leucine-rich repeats, Pfam:PF00560 Length = 1136 Score = 27.9 bits (59), Expect = 5.6 Identities = 27/86 (31%), Positives = 40/86 (46%), Gaps = 4/86 (4%) Frame = +1 Query: 127 PSQVKELNLD-NCRSTNIVGLTDEYTNLQILSLNNVGLT--TLKGFPTLPMLRKLELSDN 297 PS ++ L++ N S I T LQ+L+L+ LT L L+ L L N Sbjct: 161 PSSLQFLDISSNTFSGQIPSGLANLTQLQLLNLSYNQLTGEIPASLGNLQSLQYLWLDFN 220 Query: 298 RISNGL-TFLSGCKKLAHLNLSGNKI 372 + L + +S C L HL+ S N+I Sbjct: 221 LLQGTLPSAISNCSSLVHLSASENEI 246 >At3g12610.1 68416.m01570 DNA-damage-repair/toleration protein, putative (DRT100) similar to DNA-damage-repair/toleration protein DRT100 [Precursor] SWISS-PROT:Q00874, NCBI_gi:5701788; contains multiple LRR repeats Pfam profile: PF00560 Length = 372 Score = 27.9 bits (59), Expect = 5.6 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 4/80 (5%) Frame = +1 Query: 145 LNLD-NCRSTNIVGLTDEYTNLQILSLNNVGL--TTLKGFPTLPMLRKLELSDNRISNGL 315 LNLD N + I G + L + +L+ L T F + L L+LS N +S + Sbjct: 260 LNLDCNSLTGPIPGSLLSNSGLDVANLSRNALEGTIPDVFGSKTYLVSLDLSHNSLSGRI 319 Query: 316 T-FLSGCKKLAHLNLSGNKI 372 LS K + HL++S NK+ Sbjct: 320 PDSLSSAKFVGHLDISHNKL 339 >At1g65070.1 68414.m07377 DNA mismatch repair MutS family protein contains Pfam profile PF00488: MutS domain V Length = 857 Score = 27.9 bits (59), Expect = 5.6 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +1 Query: 205 LQILSLNNVGLTTLKGFPTLPMLRKLELSDNRISNGLTFLSGC 333 L + L V T T LRK +SDNR++ + L GC Sbjct: 133 LTVRELCTVRSTLTAATSTFQKLRKAAISDNRVTPLVDILQGC 175 >At5g06860.1 68418.m00776 polygalacturonase inhibiting protein 1 (PGIP1) identical to polygalacturonase inhibiting protein 1 (PGIP1) [Arabidopsis thaliana] gi|7800199|gb|AAF69827; contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611 Length = 330 Score = 27.5 bits (58), Expect = 7.4 Identities = 24/89 (26%), Positives = 44/89 (49%), Gaps = 8/89 (8%) Frame = +1 Query: 130 SQVKELNLDNCRSTNIVGLTDEYT----NLQILSL--NNVGLTTLKGFPTLPMLRKLELS 291 +++K L + TN+ G ++ NL+ L L N++ + TLP + LELS Sbjct: 116 AKLKNLRMLRLSWTNLTGPIPDFISQLKNLEFLELSFNDLSGSIPSSLSTLPKILALELS 175 Query: 292 DNRISNGL--TFLSGCKKLAHLNLSGNKI 372 N+++ + +F S + L LS N++ Sbjct: 176 RNKLTGSIPESFGSFPGTVPDLRLSHNQL 204 >At4g26090.1 68417.m03756 disease resistance protein RPS2 (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. identical to RPS2 (gi:13661831) Length = 909 Score = 27.5 bits (58), Expect = 7.4 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = +1 Query: 253 FPTLPMLRKLELSDNRISNGLTFLSGCKKLAHLNLSGNKIKDL 381 F +P+LR L+LS I+ + +L HL++SG KI L Sbjct: 554 FMHMPVLRVLDLSFTSITEIPLSIKYLVELYHLSMSGTKISVL 596 >At3g44400.1 68416.m04770 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1007 Score = 27.5 bits (58), Expect = 7.4 Identities = 27/92 (29%), Positives = 46/92 (50%), Gaps = 2/92 (2%) Frame = +1 Query: 130 SQVKELNLDNCRSTNIVGLTDEYTNLQILSLNNVG-LTTLKGFPTLPMLRKLELSDNRIS 306 +++++L+L+NC S + + NLQ LSL N + L LR+L+L + Sbjct: 740 TKLEKLDLENCSSLVKLPPSINANNLQELSLRNCSRVVELPAIENATNLRELKLQNCSSL 799 Query: 307 NGLTFLSGCKKLAHLN-LSGNKIKDLETLKPL 399 L LS K+++ L L+ N +L +L L Sbjct: 800 IELP-LSWVKRMSRLRVLTLNNCNNLVSLPQL 830 >At3g19700.1 68416.m02495 leucine-rich repeat transmembrane protein kinase, putative similar to leucine-rich receptor-like protein kinase GB:AAC36318 from [Malus domestica]; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 991 Score = 27.5 bits (58), Expect = 7.4 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 3/61 (4%) Frame = +1 Query: 199 TNLQILSLNNVGLTTL--KGFPTLPMLRKLELSDNRISNGL-TFLSGCKKLAHLNLSGNK 369 T LQ + L+N +T +G L L+ LELSDN+IS + + K L L + N Sbjct: 197 TALQWVYLSNSSITGKIPEGIKNLVRLQNLELSDNQISGEIPKEIVQLKNLRQLEIYSND 256 Query: 370 I 372 + Sbjct: 257 L 257 Score = 27.1 bits (57), Expect = 9.8 Identities = 22/68 (32%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = +1 Query: 181 GLTDEYTNLQILSLNNVGLTTLKGFPTLPMLRKLELSDNRISNGLTFLSGCKKLAH-LNL 357 G E ++L IL NN+ K L L + N +S + G KL + LNL Sbjct: 481 GKLKELSSL-ILDQNNLSGAIPKSLGLCTSLVDLNFAGNSLSEEIPESLGSLKLLNSLNL 539 Query: 358 SGNKIKDL 381 SGNK+ + Sbjct: 540 SGNKLSGM 547 >At3g11250.1 68416.m01368 60S acidic ribosomal protein P0 (RPP0C) similar to 60S acidic ribosomal protein P0 GI:2088654 [Arabidopsis thaliana] Length = 323 Score = 27.5 bits (58), Expect = 7.4 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 169 TNIVGLTDEYTNLQILSLNNVGLTTLK 249 T + L DEYT + +++ +NVG T L+ Sbjct: 15 TKLCQLIDEYTQILVVAADNVGSTQLQ 41 >At3g09200.1 68416.m01094 60S acidic ribosomal protein P0 (RPP0B) similar to putative 60S acidic ribosomal protein P0 GB:P50346 [Glycine max] Length = 320 Score = 27.5 bits (58), Expect = 7.4 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 169 TNIVGLTDEYTNLQILSLNNVGLTTLK 249 T + L DEYT + +++ +NVG T L+ Sbjct: 15 TKLCQLIDEYTQILVVAADNVGSTQLQ 41 >At1g71400.1 68414.m08246 disease resistance family protein / LRR family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-5D [Lycopersicon esculentum] gi|3894393|gb|AAC78596 Length = 847 Score = 27.5 bits (58), Expect = 7.4 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = +1 Query: 223 NNVGLTTLKGFPTLPMLRKLELSDNRISNGLT-FLSGCKKLAHLNLSGNKIKDL 381 NN T F L L++S N++ L CK L +N+ NKIKD+ Sbjct: 502 NNFSGTLPDIFSKATELVSLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDI 555 >At1g71390.1 68414.m08243 disease resistance family protein / LRR family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-5B [Lycopersicon esculentum] gi|3894391|gb|AAC78595 Length = 784 Score = 27.5 bits (58), Expect = 7.4 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Frame = +1 Query: 211 ILSLNNVGLTTLKGFPTLPMLRKLELSDNRISNGLT-FLSGCKKLAHLNLSGNKIKD 378 IL N T F L+ L++S N++ L CK L +N+ NKIKD Sbjct: 439 ILGNNKFSGTLPDIFANNTNLQSLDVSGNQLEGKFPKSLINCKGLHFVNVESNKIKD 495 >At5g45210.1 68418.m05549 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 697 Score = 27.1 bits (57), Expect = 9.8 Identities = 18/78 (23%), Positives = 40/78 (51%) Frame = +1 Query: 16 FSSLRNNLLANLKLFKVLIGIFMNMEKRIILERRGRDPSQVKELNLDNCRSTNIVGLTDE 195 +S L++ + L K+ + + +K + ++ + +++++L C S + TD Sbjct: 588 YSQLQSLCVGTKSLAKLKMINLSHSQKLLEVDELAK-ACNLEKIDLQGCTSLKSIPHTDR 646 Query: 196 YTNLQILSLNNVGLTTLK 249 NLQ L+L+ G T++K Sbjct: 647 LKNLQFLNLS--GCTSIK 662 >At5g44700.1 68418.m05477 leucine-rich repeat transmembrane protein kinase, putative Length = 1252 Score = 27.1 bits (57), Expect = 9.8 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 3/59 (5%) Frame = +1 Query: 199 TNLQILSLNNVGLTTL--KGFPTLPMLRKLELSDNRISNGLTFLSG-CKKLAHLNLSGN 366 TNL L L T + F + L L++S N +S + G CKKL H++L+ N Sbjct: 600 TNLDRLRLGKNQFTGRIPRTFGKISELSLLDISRNSLSGIIPVELGLCKKLTHIDLNNN 658 >At4g34220.1 68417.m04862 leucine-rich repeat transmembrane protein kinase, putative protein kinase TMKL1, Arabidopsis thaliana, PID:E353150 Length = 757 Score = 27.1 bits (57), Expect = 9.8 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +1 Query: 280 LELSDNRISNGLTFLSGCKKLAHLNLSGNKI 372 L+LS N ++ L G K L +LNLS NK+ Sbjct: 201 LDLSSNLLNGSLPKDLGGKSLHYLNLSHNKV 231 >At4g20140.1 68417.m02947 leucine-rich repeat transmembrane protein kinase, putative Cf-2.2, Lycopersicon pimpinellifolium, PIR:T10515 Length = 1249 Score = 27.1 bits (57), Expect = 9.8 Identities = 26/65 (40%), Positives = 32/65 (49%), Gaps = 7/65 (10%) Frame = +1 Query: 193 EYTNLQILSLNNVGLTTLKG-FP-TLPMLRKLELSDNRISNGLTF-----LSGCKKLAHL 351 E N Q L +G L G P TL +R+L L D SN LT L CKKL H+ Sbjct: 594 ELGNSQNLDRLRLGKNQLTGKIPWTLGKIRELSLLDMS-SNALTGTIPLQLVLCKKLTHI 652 Query: 352 NLSGN 366 +L+ N Sbjct: 653 DLNNN 657 >At3g51560.1 68416.m05646 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1253 Score = 27.1 bits (57), Expect = 9.8 Identities = 26/101 (25%), Positives = 48/101 (47%), Gaps = 13/101 (12%) Frame = +1 Query: 130 SQVKELNLDNCRSTNIVGL-TDEYTNLQILSLNNVG-LTTLKGFPTLPMLRKLELSDNRI 303 S++ L+L+NC+ + + + ++L +L+L+ L ++G P L +L L+ I Sbjct: 757 SELVVLDLENCKRLHKLPMGIGNLSSLAVLNLSGCSELEDIQGIPR--NLEELYLAGTAI 814 Query: 304 SNGLTF-----------LSGCKKLAHLNLSGNKIKDLETLK 393 + L CK+L HL + + +K L TLK Sbjct: 815 QEVTSLIKHLSELVVLDLQNCKRLQHLPMEISNLKSLVTLK 855 >At3g15410.1 68416.m01955 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Hcr2-5D [Lycopersicon esculentum] gi|3894393|gb|AAC78596; identical to leucine-rich repeat protein [Arabidopsis thaliana] gi|2760084|emb|CAA76000 Length = 584 Score = 27.1 bits (57), Expect = 9.8 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = +1 Query: 271 LRKLELSDNRISNGLTFLSGCKKLAHLNLSGNKIKDL 381 L L+ ++N+IS+ + C KL+ L++ GNK+ L Sbjct: 139 LSDLKATNNQISSLPEDMVNCSKLSKLDVEGNKLTAL 175 >At2g25490.1 68415.m03052 F-box family protein (FBL6) contains similarity to grr1 GI:2407790 from [Glycine max] Length = 628 Score = 27.1 bits (57), Expect = 9.8 Identities = 17/60 (28%), Positives = 25/60 (41%) Frame = +1 Query: 40 LANLKLFKVLIGIFMNMEKRIILERRGRDPSQVKELNLDNCRSTNIVGLTDEYTNLQILS 219 L L K+ N+ R+I R+ ++ LN+D C + L N QILS Sbjct: 488 LIQSSLVKINFSGCSNLTDRVISAITARNGWTLEVLNIDGCSNITDASLVSIAANCQILS 547 >At1g72300.1 68414.m08358 leucine-rich repeat transmembrane protein kinase, putative similar to GI:3641252 from [Malus x domestica] (Plant Mol. Biol. 40 (6), 945-957 (1999)) Length = 1095 Score = 27.1 bits (57), Expect = 9.8 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Frame = +1 Query: 262 LPMLRKLELSDNRISN---GLTFLSGCKKLAHLNLSGN 366 L L SDN+++N L+ L GCKKL+ L ++ N Sbjct: 415 LESLSFFTFSDNKMTNLTGALSILQGCKKLSTLIMAKN 452 >At1g54480.1 68414.m06214 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum] Length = 550 Score = 27.1 bits (57), Expect = 9.8 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = +1 Query: 271 LRKLELSDNRISNGLT--FLSGCKKLAHLNLSGN 366 + L+LS N S L F++GC L HL LS N Sbjct: 58 ITSLDLSYNNFSGKLPRRFVTGCFSLKHLKLSHN 91 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,477,351 Number of Sequences: 28952 Number of extensions: 192905 Number of successful extensions: 731 Number of sequences better than 10.0: 111 Number of HSP's better than 10.0 without gapping: 660 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 722 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1226538000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -