BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0976 (689 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g18830.2 68418.m02238 squamosa promoter-binding protein-like ... 30 1.7 At5g18830.1 68418.m02237 squamosa promoter-binding protein-like ... 30 1.7 At1g69280.1 68414.m07943 expressed protein 29 2.2 At5g38680.1 68418.m04677 kelch repeat-containing F-box family pr... 28 5.1 At2g26430.1 68415.m03171 ania-6a type cyclin (RCY1) nearly ident... 28 6.7 >At5g18830.2 68418.m02238 squamosa promoter-binding protein-like 7 (SPL7) identical to squamosa promoter binding protein-like 7 [Arabidopsis thaliana] GI:5931635; contains Pfam profile PF03110: SBP domain Length = 775 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +2 Query: 455 QRSNRMYCIPWQLYSIPCCCESIAFKIRNTTLPRWRRLSGG 577 +R R+ C + +PC C + K+ + LP+ +R+ GG Sbjct: 92 KRDPRLICSNFIEGMLPCSCPELDQKLEDAELPKKKRVRGG 132 >At5g18830.1 68418.m02237 squamosa promoter-binding protein-like 7 (SPL7) identical to squamosa promoter binding protein-like 7 [Arabidopsis thaliana] GI:5931635; contains Pfam profile PF03110: SBP domain Length = 801 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +2 Query: 455 QRSNRMYCIPWQLYSIPCCCESIAFKIRNTTLPRWRRLSGG 577 +R R+ C + +PC C + K+ + LP+ +R+ GG Sbjct: 92 KRDPRLICSNFIEGMLPCSCPELDQKLEDAELPKKKRVRGG 132 >At1g69280.1 68414.m07943 expressed protein Length = 400 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +2 Query: 443 CGYSQRSNRMYCIPWQLYSIPCCCESIAFKIRNTTLPR 556 C Y+ ++C W +S CCC S + K+ + + R Sbjct: 344 CDYNSSCGWLFCCHWSCWSC-CCCSSSSKKVVDDEMTR 380 >At5g38680.1 68418.m04677 kelch repeat-containing F-box family protein contains F-box domain Pfam:PF00646 and Kelch motif Pfam:PF01344 Length = 357 Score = 28.3 bits (60), Expect = 5.1 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +2 Query: 452 SQRSNRMYC-IPWQLYSIPCCCESIAFKIRNTTLPRWRRLSG 574 S +S+ YC I LYS+ F+ +T L RWR+L G Sbjct: 257 SYKSSYDYCEIENVLYSVEKTWRGTVFRWYDTELGRWRKLEG 298 >At2g26430.1 68415.m03171 ania-6a type cyclin (RCY1) nearly identical to ania-6a type cyclin [Arabidopsis thaliana] GI:13924511 Length = 416 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -3 Query: 648 DLTF*THLNEIYVFLSNYICVL*TPPDNR 562 ++ F H+ + F+SNY+ L TPP+ R Sbjct: 144 EMGFVCHVEHPHKFISNYLATLETPPELR 172 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,816,977 Number of Sequences: 28952 Number of extensions: 305213 Number of successful extensions: 666 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 659 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 666 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1467502800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -