BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0970 (510 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0017 - 114497-114547,114700-114816,114917-114997,115312-11... 28 5.0 >07_01_0017 - 114497-114547,114700-114816,114917-114997,115312-115371, 116029-116238,116412-116720,116790-117080 Length = 372 Score = 27.9 bits (59), Expect = 5.0 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = +1 Query: 82 PTHFQEGTVILFVDAIGTGSAFSLASTTIGALFYQYY*FKQH 207 P H G ++L V AIG AF + IG L + F H Sbjct: 243 PLHVLHGIIVLCVSAIGCPDAFIHSVQEIGPLKIERLDFSDH 284 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,430,646 Number of Sequences: 37544 Number of extensions: 179501 Number of successful extensions: 292 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 292 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 292 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1095026320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -