BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0970 (510 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1912| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.73 SB_44703| Best HMM Match : Extensin_2 (HMM E-Value=0.077) 27 6.8 >SB_1912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 30.7 bits (66), Expect = 0.73 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +1 Query: 352 DILVLCLDDIFVALIVTHYIYSLYTSTGLFYILYNRLLSFIK 477 DIL LC I +I YI+ S G+FY L + F++ Sbjct: 50 DILTLCSAVILYCVIENQYIFRQNDSDGIFYKLRRLFVGFVE 91 >SB_44703| Best HMM Match : Extensin_2 (HMM E-Value=0.077) Length = 757 Score = 27.5 bits (58), Expect = 6.8 Identities = 17/67 (25%), Positives = 32/67 (47%) Frame = +1 Query: 106 VILFVDAIGTGSAFSLASTTIGALFYQYY*FKQHSCVFQ*TQEYLIVLIDIIRIQMCLYV 285 +I+ +D +F+L TT Y + + +C F+ Q YL L D + ++ + Sbjct: 596 LIILLDVWHFMRSFALGCTTKSHALYPAFMSRLSACTFEWDQHYLKALEDAKKSELEMRG 655 Query: 286 VKNFSRY 306 V + SR+ Sbjct: 656 VWSLSRF 662 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,888,995 Number of Sequences: 59808 Number of extensions: 237959 Number of successful extensions: 388 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 387 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1123894172 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -