BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0970 (510 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U88176-1|AAO91741.1| 459|Caenorhabditis elegans Hypothetical pr... 30 0.85 Z80215-14|CAI79138.1| 662|Caenorhabditis elegans Hypothetical p... 27 7.9 Z80215-13|CAI79137.1| 640|Caenorhabditis elegans Hypothetical p... 27 7.9 Z80215-12|CAB02277.1| 652|Caenorhabditis elegans Hypothetical p... 27 7.9 >U88176-1|AAO91741.1| 459|Caenorhabditis elegans Hypothetical protein F18F11.5 protein. Length = 459 Score = 30.3 bits (65), Expect = 0.85 Identities = 20/62 (32%), Positives = 28/62 (45%) Frame = +3 Query: 81 SYAFPGGDCYFIC*RYWNRICLFLSLNNDRGFVLPILLI*TTQLCISMNSRVPNSLDRYH 260 S A G +F +N I + + + GFV+ I LI + + NSLDRYH Sbjct: 331 SLAAVAGGVFFAIFLIYNGIQIACQCSLNEGFVVLIALILLPIIILLTTLCCNNSLDRYH 390 Query: 261 TD 266 D Sbjct: 391 AD 392 >Z80215-14|CAI79138.1| 662|Caenorhabditis elegans Hypothetical protein C36B1.12c protein. Length = 662 Score = 27.1 bits (57), Expect = 7.9 Identities = 8/21 (38%), Positives = 16/21 (76%) Frame = +1 Query: 229 QEYLIVLIDIIRIQMCLYVVK 291 Q Y +L+D+I + +C++V+K Sbjct: 392 QPYAFILLDVINMALCMHVLK 412 >Z80215-13|CAI79137.1| 640|Caenorhabditis elegans Hypothetical protein C36B1.12b protein. Length = 640 Score = 27.1 bits (57), Expect = 7.9 Identities = 8/21 (38%), Positives = 16/21 (76%) Frame = +1 Query: 229 QEYLIVLIDIIRIQMCLYVVK 291 Q Y +L+D+I + +C++V+K Sbjct: 392 QPYAFILLDVINMALCMHVLK 412 >Z80215-12|CAB02277.1| 652|Caenorhabditis elegans Hypothetical protein C36B1.12a protein. Length = 652 Score = 27.1 bits (57), Expect = 7.9 Identities = 8/21 (38%), Positives = 16/21 (76%) Frame = +1 Query: 229 QEYLIVLIDIIRIQMCLYVVK 291 Q Y +L+D+I + +C++V+K Sbjct: 392 QPYAFILLDVINMALCMHVLK 412 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,903,086 Number of Sequences: 27780 Number of extensions: 186890 Number of successful extensions: 397 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 387 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 397 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 988489374 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -