BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0966 (812 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0710 + 23792138-23792293,23792974-23793257,23794344-237944... 28 7.7 >06_03_0710 + 23792138-23792293,23792974-23793257,23794344-23794499, 23795318-23795804,23795864-23796181,23796773-23797165, 23797752-23798021 Length = 687 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -1 Query: 497 WFSFLWSLHNGIFIINKFYYYPH*LWNCGYR 405 W ++ +H G ++ K Y+ H +NCG R Sbjct: 606 WLKYVSFMHYGFNLLLKAQYHGHLTYNCGSR 636 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,435,477 Number of Sequences: 37544 Number of extensions: 351329 Number of successful extensions: 749 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 730 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 749 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2221181676 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -