BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0966 (812 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 29 0.068 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 29 0.068 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 23 2.5 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 23 2.5 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 23 3.4 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 28.7 bits (61), Expect = 0.068 Identities = 10/40 (25%), Positives = 23/40 (57%) Frame = -3 Query: 249 FVRIVCYVVHFTEVLIVSEEAIFLVDSLRDVSDTGVCIVF 130 F+ IVC+V + + ++E +++ L + +G C++F Sbjct: 418 FIAIVCFVSYLIGLFCITEGGMYVFQLLDSYAVSGFCLLF 457 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 28.7 bits (61), Expect = 0.068 Identities = 10/40 (25%), Positives = 23/40 (57%) Frame = -3 Query: 249 FVRIVCYVVHFTEVLIVSEEAIFLVDSLRDVSDTGVCIVF 130 F+ IVC+V + + ++E +++ L + +G C++F Sbjct: 471 FIAIVCFVSYLIGLFCITEGGMYVFQLLDSYAVSGFCLLF 510 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 23.4 bits (48), Expect = 2.5 Identities = 11/44 (25%), Positives = 21/44 (47%) Frame = -3 Query: 168 LRDVSDTGVCIVFGVLTLATVLRIALSEITAIILPRTFFIHRSV 37 L+ SD C++FGVL + +++ T+ I+ S+ Sbjct: 7 LQAESDVSSCVIFGVLFVLFSFLRTRTKLQPTYFHHTYIIYESL 50 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 23.4 bits (48), Expect = 2.5 Identities = 11/44 (25%), Positives = 21/44 (47%) Frame = -3 Query: 168 LRDVSDTGVCIVFGVLTLATVLRIALSEITAIILPRTFFIHRSV 37 L+ SD C++FGVL + +++ T+ I+ S+ Sbjct: 7 LQAESDVSSCVIFGVLFVLFSFLRTRTKLQPTYFHHTYIIYESL 50 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 23.0 bits (47), Expect = 3.4 Identities = 13/48 (27%), Positives = 20/48 (41%) Frame = +1 Query: 64 WKYDSGNLAQCYPQYSCKCQDAKNNTYACIRHIAERIDKKYCLFADNE 207 WK D G L + S KN T C ++ R D + + ++E Sbjct: 218 WKNDEGTLRKSPSLTSLNAYLIKNQTITCPIKVSWRADGQIMVDYEDE 265 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,940 Number of Sequences: 438 Number of extensions: 4479 Number of successful extensions: 19 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25853301 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -