BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0962 (740 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor pro... 23 3.0 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 23 4.0 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 22 7.0 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 22 7.0 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 22 7.0 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 22 7.0 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 22 7.0 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 7.0 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 21 9.2 >X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor protein. Length = 168 Score = 23.0 bits (47), Expect = 3.0 Identities = 19/79 (24%), Positives = 27/79 (34%), Gaps = 5/79 (6%) Frame = +2 Query: 467 HPRHQGRQGCRPAVRIGRRMHHPGSGRPRPALRPVQEGRLPLRQVALRAEDRPQHPLVPS 646 HPR + R ++ P P P LR E + + RP HP + Sbjct: 85 HPRLRREAESEAEPGNNRPVYIPQPRPPHPRLRREPEAEPGNNRPVYIPQPRPPHPRLRR 144 Query: 647 YP-----GKRPMFSPATLP 688 P RP++ P P Sbjct: 145 EPEAEPGNNRPVYIPQPRP 163 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/32 (28%), Positives = 14/32 (43%) Frame = -3 Query: 336 DNDDGSPLCSPRRCPANAFPLYRWIRQRRGYP 241 D G+P+C N L +W + G+P Sbjct: 324 DRMQGNPICVQIPWDKNVEALAKWANGQTGFP 355 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 21.8 bits (44), Expect = 7.0 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 Query: 618 IGRNTPSYQAIQENAQCSRPLRFHLSEPTH 707 IG +TP + I NA RP EPTH Sbjct: 147 IGPSTPFPRFIPPNAYRFRPPLNPRFEPTH 176 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 7.0 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 Query: 618 IGRNTPSYQAIQENAQCSRPLRFHLSEPTH 707 IG +TP + I NA RP EPTH Sbjct: 150 IGPSTPFPRFIPPNAYRFRPPLNPRFEPTH 179 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 7.0 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 Query: 618 IGRNTPSYQAIQENAQCSRPLRFHLSEPTH 707 IG +TP + I NA RP EPTH Sbjct: 150 IGPSTPFPRFIPPNAYRFRPPLNPRFEPTH 179 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 7.0 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 Query: 618 IGRNTPSYQAIQENAQCSRPLRFHLSEPTH 707 IG +TP + I NA RP EPTH Sbjct: 150 IGPSTPFPRFIPPNAYRFRPPLNPRFEPTH 179 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 7.0 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 Query: 618 IGRNTPSYQAIQENAQCSRPLRFHLSEPTH 707 IG +TP + I NA RP EPTH Sbjct: 150 IGPSTPFPRFIPPNAYRFRPPLNPRFEPTH 179 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 7.0 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = +2 Query: 440 GLPAGEEGHHPRHQGRQGCRPAVRIGRRMHHPGSGRPRPALRP 568 G G+ G H G +G +G + P SG P P P Sbjct: 1821 GSQYGQYGAPYDHYGSRGSVGRRSVGSARNIPVSGSPEPPPPP 1863 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 21.4 bits (43), Expect = 9.2 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 Query: 404 DPLPEG*RWNASGLPAGEEG 463 DP P + AS + AGEEG Sbjct: 589 DPXPNTCKVIASSVSAGEEG 608 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,815 Number of Sequences: 438 Number of extensions: 5066 Number of successful extensions: 13 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -