BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0961 (600 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57| Best HMM Match : zf-C2H2 (HMM E-Value=0) 32 0.41 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 28 5.0 >SB_57| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1498 Score = 31.9 bits (69), Expect = 0.41 Identities = 19/63 (30%), Positives = 27/63 (42%) Frame = -3 Query: 244 FRSRDTSPNNCTALPNYFGPAVYSVQRNHDYFLLTLSVRNYVCEVNDFLFICKRHVKGCT 65 F S+DT+ C +F VY V+ L R + CEV D + + H+K T Sbjct: 1168 FHSKDTTGWKCHHCDEFFSTHVYLVEHQES----VLGEREFTCEVCDKSLLTRAHLKRHT 1223 Query: 64 DFH 56 H Sbjct: 1224 MNH 1226 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 28.3 bits (60), Expect = 5.0 Identities = 21/48 (43%), Positives = 25/48 (52%), Gaps = 5/48 (10%) Frame = +1 Query: 376 RPRTGKRSVGRSPT-RWTDDLVKITG-SRWMQGAMDR---PHSRTSVG 504 R R G R + R P R D ++TG SRW QG DR P +SVG Sbjct: 524 REREG-RHMDRGPRDRHEGDYTEVTGGSRWSQGDRDRDRGPDRESSVG 570 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,912,222 Number of Sequences: 59808 Number of extensions: 430160 Number of successful extensions: 940 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 812 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 940 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1451595000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -