BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0961 (600 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC131628-1|AAI31629.1| 828|Homo sapiens KIAA1553 protein. 32 1.3 AL355586-3|CAI16110.1| 828|Homo sapiens RP11-59I9.2 protein. 32 1.3 AB046773-1|BAB13379.1| 670|Homo sapiens KIAA1553 protein protein. 32 1.3 >BC131628-1|AAI31629.1| 828|Homo sapiens KIAA1553 protein. Length = 828 Score = 32.3 bits (70), Expect = 1.3 Identities = 22/63 (34%), Positives = 29/63 (46%) Frame = +3 Query: 213 QLFGEVSLDRNKRNCSNARKQLLESLNFGCTTRPFTTYDYLIYIVKEVFIFSIKQTTYWQ 392 +LF +V R C A K+ LESL+ LI EV+ S+K T WQ Sbjct: 277 ELFSDVDFSRGCSACGFAAKRKLESLHL-----------QLIRNYVEVYYPSVKDTAVWQ 325 Query: 393 AQC 401 A+C Sbjct: 326 AEC 328 >AL355586-3|CAI16110.1| 828|Homo sapiens RP11-59I9.2 protein. Length = 828 Score = 32.3 bits (70), Expect = 1.3 Identities = 22/63 (34%), Positives = 29/63 (46%) Frame = +3 Query: 213 QLFGEVSLDRNKRNCSNARKQLLESLNFGCTTRPFTTYDYLIYIVKEVFIFSIKQTTYWQ 392 +LF +V R C A K+ LESL+ LI EV+ S+K T WQ Sbjct: 277 ELFSDVDFSRGCSACGFAAKRKLESLHL-----------QLIRNYVEVYYPSVKDTAVWQ 325 Query: 393 AQC 401 A+C Sbjct: 326 AEC 328 >AB046773-1|BAB13379.1| 670|Homo sapiens KIAA1553 protein protein. Length = 670 Score = 32.3 bits (70), Expect = 1.3 Identities = 22/63 (34%), Positives = 29/63 (46%) Frame = +3 Query: 213 QLFGEVSLDRNKRNCSNARKQLLESLNFGCTTRPFTTYDYLIYIVKEVFIFSIKQTTYWQ 392 +LF +V R C A K+ LESL+ LI EV+ S+K T WQ Sbjct: 119 ELFSDVDFSRGCSACGFAAKRKLESLHL-----------QLIRNYVEVYYPSVKDTAVWQ 167 Query: 393 AQC 401 A+C Sbjct: 168 AEC 170 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,568,335 Number of Sequences: 237096 Number of extensions: 2001169 Number of successful extensions: 3653 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3554 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3650 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6297951520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -