BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0953 (698 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g05890.1 68414.m00617 zinc finger protein-related contains lo... 30 1.3 At5g43660.1 68418.m05336 expressed protein similar to unknown pr... 29 2.2 At3g60910.1 68416.m06814 expressed protein low similarity to PIR... 28 5.2 At2g31830.1 68415.m03887 endonuclease/exonuclease/phosphatase fa... 28 5.2 At5g50100.1 68418.m06204 expressed protein contains Pfam domain ... 28 6.8 At2g39320.1 68415.m04827 OTU-like cysteine protease family prote... 28 6.8 At3g23640.1 68416.m02973 glycosyl hydrolase family 31 protein si... 27 9.0 >At1g05890.1 68414.m00617 zinc finger protein-related contains low similarity to zinc finger proteins and Pfam PF01485: IBR domain Length = 552 Score = 30.3 bits (65), Expect = 1.3 Identities = 19/52 (36%), Positives = 25/52 (48%) Frame = +3 Query: 525 WRGWIDLERLDGAGCLELDEERAAIEDAALRDQIERYNQRLRDFEDKQRAYR 680 W G+I DG GCL L + A RD I+ +L EDK++ YR Sbjct: 158 WTGYISTTINDGPGCLMLKCPDPSCPAAIGRDMID----KLASKEDKEKYYR 205 >At5g43660.1 68418.m05336 expressed protein similar to unknown protein (gb|AAB72163.1) Length = 361 Score = 29.5 bits (63), Expect = 2.2 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 3/41 (7%) Frame = +3 Query: 240 DQKAKFESDDLFKRLSRE---SEVRYTGYRDRPPEERQMRF 353 ++KAKF SD L K +SRE +R+ YR+ Q RF Sbjct: 48 EEKAKFMSDILHKYISREECAKAIRFKNYREWIMSNYQPRF 88 >At3g60910.1 68416.m06814 expressed protein low similarity to PIR|I46078 endothelin converting enzyme from Bos primigenius taurus Length = 252 Score = 28.3 bits (60), Expect = 5.2 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +3 Query: 150 PSPLAGMLPFDSIYEQPKPRFIFKMPRVVPDQKAKFESDDLFK 278 P GMLP D + E P FI+ + D++A+ S L + Sbjct: 207 PITSEGMLPHDYVLEDPDSHFIYICKKKDEDEEAQLPSYPLME 249 >At2g31830.1 68415.m03887 endonuclease/exonuclease/phosphatase family protein belongs to Pfam:PF03372: Endonuclease/Exonuclease/phosphatase family; contains 4 WD-40 repeats (PF00400);similar to SP:Q01968 Inositol polyphosphate 5-phosphatase OCRL-1 (EC 3.1.3.-)(Lowe's oculocerebrorenal syndrome protein) (SP:Q01968) [Homo sapiens] Length = 1144 Score = 28.3 bits (60), Expect = 5.2 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 3/50 (6%) Frame = +1 Query: 535 GSIWNGSMAPAVLSWTRREQRLK-MQHY--VIRSRGTINDYVILKTSSGH 675 GSIW GSM + W RL+ + H+ + T D + + SSG+ Sbjct: 459 GSIWTGSMNGVIAQWDGNGSRLREVNHHQQAVLCFCTFGDRIYVGYSSGY 508 >At5g50100.1 68418.m06204 expressed protein contains Pfam domain PF04134: Protein of unknown function, DUF393 Length = 214 Score = 27.9 bits (59), Expect = 6.8 Identities = 16/57 (28%), Positives = 27/57 (47%) Frame = +3 Query: 321 DRPPEERQMRFMSGCREGHTEIAFTGTGTNLQLVFDHSPYNNRGCDFQKENGKAHIV 491 D P R++ + E H I F +N D+SP +N+G D++ G+ H + Sbjct: 82 DCPLCMREVNMLMERNEKHGTIKFVDISSN-----DYSPEDNQGLDYKTVMGQIHAI 133 >At2g39320.1 68415.m04827 OTU-like cysteine protease family protein contains Pfam profile PF02338: OTU-like cysteine protease Length = 189 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/51 (27%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +2 Query: 323 PASRRTPD-AIHERLPRGTHRDSVYRYRHKPSACLRSLTLQQPWLRLSKGK 472 P S++ PD IH G H +S+Y+ + + S + W++L + K Sbjct: 77 PKSQKEPDKVIHMSYLAGIHFNSIYKKNKEKGSRSSSSSSSAVWMKLQRKK 127 >At3g23640.1 68416.m02973 glycosyl hydrolase family 31 protein similar to alpha-glucosidase II from SP:Q9F234 [Bacillus thermoamyloliquefaciens]; contains Pfam profile: PF01055 Glycosyl hydrolases family 31 Length = 991 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 534 WIDLERLDGAGCLELDEERAAIEDAALRD 620 W+D++ +DG C D+ER A +D Sbjct: 233 WMDIDYMDGFRCFTFDKERFPDPSALAKD 261 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,440,615 Number of Sequences: 28952 Number of extensions: 338731 Number of successful extensions: 982 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 955 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 982 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -