BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0951 (553 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 27 0.14 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 25 0.33 AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical pro... 21 5.4 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 26.6 bits (56), Expect = 0.14 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 37 PRVQPVPGGPIFVPQPVGSPAIKLSASAYWILRLPFV 147 P+V P+P PIF P + AI SA+ + + +V Sbjct: 178 PQVPPLPLPPIFAPTMINPSAICESAAQLLFMNVQWV 214 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 25.4 bits (53), Expect = 0.33 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 37 PRVQPVPGGPIFVPQPVGSPAIKLSASAYWILRLPFV 147 P+V P+P PIF P + AI SA+ + + +V Sbjct: 178 PQVPPLPLPPIFPPTMINPSAICESAAQLIFMNVQWV 214 >AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical protein protein. Length = 102 Score = 21.4 bits (43), Expect = 5.4 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -1 Query: 427 YLKTIHC**EIKYVLSSRSLPQKKFY 350 + K I+C ++L S SLP + FY Sbjct: 19 FSKFINCHYTSGHLLGSSSLPLRSFY 44 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,855 Number of Sequences: 336 Number of extensions: 1933 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13621010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -