BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0951 (553 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g29120.2 68414.m03565 expressed protein 32 0.29 At1g29120.1 68414.m03564 expressed protein 32 0.29 At4g01050.1 68417.m00142 hydroxyproline-rich glycoprotein family... 29 1.6 At3g22490.1 68416.m02843 late embryogenesis abundant protein, pu... 29 1.6 At1g61560.1 68414.m06935 seven transmembrane MLO family protein ... 29 1.6 At5g09620.1 68418.m01113 octicosapeptide/Phox/Bem1p (PB1) domain... 29 2.1 At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 29 2.1 At3g10040.1 68416.m01204 expressed protein est match 29 2.1 At1g71520.1 68414.m08267 AP2 domain-containing transcription fac... 28 3.6 At5g50290.1 68418.m06227 hypothetical protein 27 6.3 At5g63920.1 68418.m08026 DNA topoisomerase III alpha, putative s... 27 8.3 >At1g29120.2 68414.m03565 expressed protein Length = 455 Score = 31.9 bits (69), Expect = 0.29 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +1 Query: 106 LSASAYWILRLPFVYCDERGALPRPRTAPSSPLSQGVILA 225 +S ++ WI + PF Y +RG +P + + S GV+ A Sbjct: 1 MSTASSWIQQPPFRYLPDRGGFSKPSSRSARQFSSGVVSA 40 >At1g29120.1 68414.m03564 expressed protein Length = 455 Score = 31.9 bits (69), Expect = 0.29 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +1 Query: 106 LSASAYWILRLPFVYCDERGALPRPRTAPSSPLSQGVILA 225 +S ++ WI + PF Y +RG +P + + S GV+ A Sbjct: 1 MSTASSWIQQPPFRYLPDRGGFSKPSSRSARQFSSGVVSA 40 >At4g01050.1 68417.m00142 hydroxyproline-rich glycoprotein family protein Length = 466 Score = 29.5 bits (63), Expect = 1.6 Identities = 22/61 (36%), Positives = 32/61 (52%) Frame = +1 Query: 46 QPVPGGPIFVPQPVGSPAIKLSASAYWILRLPFVYCDERGALPRPRTAPSSPLSQGVILA 225 +PVP P VP+PV PAI+ + +A ++ P E A P+P + P SP + L Sbjct: 403 KPVPE-PEPVPEPVPVPAIEAAVAAQ-VITEP----TETEAKPKPHSRPLSPYASYPDLK 456 Query: 226 P 228 P Sbjct: 457 P 457 >At3g22490.1 68416.m02843 late embryogenesis abundant protein, putative / LEA protein, putative similar to LEA protein in group 5 (AtECP31) [Arabidopsis thaliana] GI:1526422; contains Pfam profile PF04927: Seed maturation protein Length = 262 Score = 29.5 bits (63), Expect = 1.6 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -3 Query: 173 GSAPRSSQYTNGRRRIQ*ADADSLMAGEPTGCGTKIGPPG 54 G A ++ T G + + +DA ++ A E CGT + PG Sbjct: 139 GEALEATVQTAGNKPVDQSDAAAIQAAEVRACGTNVIAPG 178 >At1g61560.1 68414.m06935 seven transmembrane MLO family protein / MLO-like protein 6 (MLO6) idenctical to membrane protein Mlo6 [Arabidopsis thaliana] gi|14091582|gb|AAK53799; similar to MLO protein SWISS-PROT:P93766, NCBI_gi:1877221 [Hordeum vulgare][Barley]; contains Pfam profile PF03094: Mlo family Length = 583 Score = 29.5 bits (63), Expect = 1.6 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -3 Query: 233 NSGASITPCDSGEEGAVRGRGSAPRSSQYTNGRRRI 126 N AS+ PC + EE G+ P+ + N RR++ Sbjct: 87 NIAASMHPCSASEEARKYGKKDVPKEDEEENLRRKL 122 >At5g09620.1 68418.m01113 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein predicted proteins, Arabidopsis thaliana and Drosophila melanogaster contains Pfam profile PF00564: PB1 domain Length = 531 Score = 29.1 bits (62), Expect = 2.1 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 Query: 40 RVQPVPGGPIFVPQPVGSPAI 102 +V P+P P+ VPQPV P + Sbjct: 195 KVAPIPPSPVKVPQPVPEPVV 215 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 29.1 bits (62), Expect = 2.1 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -3 Query: 254 NVQSASPNSGASITPCDSGEEGAVRGRGSAPRSSQYTNG 138 ++ + P SG P +G + G G+ PR SQ+T+G Sbjct: 205 HLSNGPPPSGMPGGPLSNGPPPPMMGPGAFPRGSQFTSG 243 >At3g10040.1 68416.m01204 expressed protein est match Length = 431 Score = 29.1 bits (62), Expect = 2.1 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = -3 Query: 260 SSNVQSASPNSGASITPCDSGEEGAVRGRGSAPRSSQYTNGRRRI 126 +S + SP SG CD + G+ G G P S T+G+R++ Sbjct: 57 ASKPKQMSPISGGG---CDDEDRGSGSGSGCNPEDSAGTDGKRKL 98 >At1g71520.1 68414.m08267 AP2 domain-containing transcription factor, putative Length = 143 Score = 28.3 bits (60), Expect = 3.6 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 1/67 (1%) Frame = -3 Query: 338 LHF*RSLTSMTCSFSRILFCKLTL-ICSSNVQSASPNSGASITPCDSGEEGAVRGRGSAP 162 LH SL + +F +L L I ++Q A+ ++G ++ D+G GAV G G Sbjct: 60 LHRPSSLDDESFNFPHLLTTSLASNISPKSIQKAASDAGMAV---DAGFHGAVSGSGGCE 116 Query: 161 RSSQYTN 141 S N Sbjct: 117 ERSSMAN 123 >At5g50290.1 68418.m06227 hypothetical protein Length = 335 Score = 27.5 bits (58), Expect = 6.3 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -3 Query: 116 DADSLMAGEPTGCGTKIGPPGTGCTLGSSVTCT 18 + DS+++ PTG + + P GC ++ TCT Sbjct: 265 NCDSVIS--PTGASSSVRPKAIGCKFQNAFTCT 295 >At5g63920.1 68418.m08026 DNA topoisomerase III alpha, putative similar to Swiss-Prot:Q9NG98 DNA topoisomerase III alpha [Drosophila melanogaster] Length = 926 Score = 27.1 bits (57), Expect = 8.3 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -3 Query: 245 SASPNSGASITPCDSGEEG--AVRGRGSAPRSSQYTNGRR 132 S + +SG + T +SG G RGRG R Q + GRR Sbjct: 844 SINNSSGNATTGSNSGGSGRRGSRGRGRGGRGGQSSGGRR 883 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,306,515 Number of Sequences: 28952 Number of extensions: 169550 Number of successful extensions: 560 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 544 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 560 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1043173136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -