BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0950 (774 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8I5Y7 Cluster: Putative uncharacterized protein; n=3; ... 34 3.4 UniRef50_A5Y732 Cluster: Transposase; n=1; Cucumis melo|Rep: Tra... 34 4.5 >UniRef50_Q8I5Y7 Cluster: Putative uncharacterized protein; n=3; Plasmodium|Rep: Putative uncharacterized protein - Plasmodium falciparum (isolate 3D7) Length = 2284 Score = 34.3 bits (75), Expect = 3.4 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +3 Query: 504 PDLLFHHFLMKSRVYSNYNKLHSTRIYNLNNH 599 P++ HFL + + YNKL+ R Y++NNH Sbjct: 9 PNVKNDHFLENKNLINEYNKLYMHRYYHINNH 40 >UniRef50_A5Y732 Cluster: Transposase; n=1; Cucumis melo|Rep: Transposase - Cucumis melo (Muskmelon) Length = 347 Score = 33.9 bits (74), Expect = 4.5 Identities = 19/60 (31%), Positives = 30/60 (50%) Frame = -1 Query: 738 PIVIYNNFEICLHQ*PWGNTGLKFLATYANSTNSSSFLQTVDYLFPHGCLSYISWYCVIC 559 P +IY F +CLH T KF + ST ++F Y+ + LSY++W+ +C Sbjct: 152 PRLIYAFFGMCLHD----QTNFKFPRVFTISTPPTTFKNL--YVTVYNPLSYVTWFYYLC 205 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 677,155,319 Number of Sequences: 1657284 Number of extensions: 12975593 Number of successful extensions: 27895 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 26775 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27882 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 65027411410 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -