BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0950 (774 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC002764-1|AAH02764.2| 528|Homo sapiens Wolf-Hirschhorn syndrom... 31 6.1 AL132868-2|CAM15219.1| 539|Homo sapiens Wolf-Hirschhorn syndrom... 31 6.1 AK222853-1|BAD96573.1| 528|Homo sapiens Wolf-Hirschhorn syndrom... 31 6.1 AF101434-1|AAC72982.1| 525|Homo sapiens Wolf-Hirschhorn syndrom... 31 6.1 AB044549-1|BAB18651.1| 549|Homo sapiens Wolf-Hirshhorn syndrome... 31 6.1 >BC002764-1|AAH02764.2| 528|Homo sapiens Wolf-Hirschhorn syndrome candidate 2 protein. Length = 528 Score = 30.7 bits (66), Expect = 6.1 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = +2 Query: 257 QIENTNPHYQNIVRRIHCQLGKCISIGTIPNILQHCIKNHLFCSHPPLT 403 ++E NP+ Q+I+ + ++G+C + +P Q+ KN L PLT Sbjct: 109 ELEEQNPNVQDILGELREKVGECEASAMLPLECQYLNKNALTTLAGPLT 157 >AL132868-2|CAM15219.1| 539|Homo sapiens Wolf-Hirschhorn syndrome candidate 2 protein. Length = 539 Score = 30.7 bits (66), Expect = 6.1 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = +2 Query: 257 QIENTNPHYQNIVRRIHCQLGKCISIGTIPNILQHCIKNHLFCSHPPLT 403 ++E NP+ Q+I+ + ++G+C + +P Q+ KN L PLT Sbjct: 120 ELEEQNPNVQDILGELREKVGECEASAMLPLECQYLNKNALTTLAGPLT 168 >AK222853-1|BAD96573.1| 528|Homo sapiens Wolf-Hirschhorn syndrome candidate 2 protein variant protein. Length = 528 Score = 30.7 bits (66), Expect = 6.1 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = +2 Query: 257 QIENTNPHYQNIVRRIHCQLGKCISIGTIPNILQHCIKNHLFCSHPPLT 403 ++E NP+ Q+I+ + ++G+C + +P Q+ KN L PLT Sbjct: 109 ELEEQNPNVQDILGELREKVGECEASAMLPLECQYLNKNALTTLAGPLT 157 >AF101434-1|AAC72982.1| 525|Homo sapiens Wolf-Hirschhorn syndrome candidate 2 protein protein. Length = 525 Score = 30.7 bits (66), Expect = 6.1 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = +2 Query: 257 QIENTNPHYQNIVRRIHCQLGKCISIGTIPNILQHCIKNHLFCSHPPLT 403 ++E NP+ Q+I+ + ++G+C + +P Q+ KN L PLT Sbjct: 106 ELEEQNPNVQDILGELREKVGECEASAMLPLECQYLNKNALTTLAGPLT 154 >AB044549-1|BAB18651.1| 549|Homo sapiens Wolf-Hirshhorn syndrome candidate 2 protein protein. Length = 549 Score = 30.7 bits (66), Expect = 6.1 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = +2 Query: 257 QIENTNPHYQNIVRRIHCQLGKCISIGTIPNILQHCIKNHLFCSHPPLT 403 ++E NP+ Q+I+ + ++G+C + +P Q+ KN L PLT Sbjct: 130 ELEEQNPNVQDILGELREKVGECEASAMLPLECQYLNKNALTTLAGPLT 178 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,555,872 Number of Sequences: 237096 Number of extensions: 2029466 Number of successful extensions: 6867 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6767 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6867 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9367263024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -