BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0950 (774 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U00064-1|AAD31935.1| 845|Caenorhabditis elegans Hypothetical pr... 29 4.9 U53139-11|AAK18936.2| 353|Caenorhabditis elegans Serpentine rec... 28 6.4 Z81575-8|CAB04634.1| 433|Caenorhabditis elegans Hypothetical pr... 28 8.5 U40941-5|AAA81710.1| 300|Caenorhabditis elegans Hypothetical pr... 28 8.5 >U00064-1|AAD31935.1| 845|Caenorhabditis elegans Hypothetical protein ZC155.3 protein. Length = 845 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -1 Query: 690 WGNTGLKFLATYANSTNSSSFLQTVDY 610 WGN KF + +ANS S FL ++DY Sbjct: 388 WGNKEAKFFSKFANSIGISMFL-SLDY 413 >U53139-11|AAK18936.2| 353|Caenorhabditis elegans Serpentine receptor, class w protein71 protein. Length = 353 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/40 (30%), Positives = 25/40 (62%) Frame = -1 Query: 642 NSSSFLQTVDYLFPHGCLSYISWYCVICCNLSTLCFSLKS 523 ++SS+L +Y+ +G + +YC++ + S +CF+L S Sbjct: 288 SASSYL---NYVIGYGSVFISFFYCIVATSHSVICFALSS 324 >Z81575-8|CAB04634.1| 433|Caenorhabditis elegans Hypothetical protein R08H2.9 protein. Length = 433 Score = 27.9 bits (59), Expect = 8.5 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 Query: 308 CQLGKCISIGTIPNILQH 361 C+L KC+ +G PN +QH Sbjct: 141 CRLQKCLKVGMDPNAVQH 158 >U40941-5|AAA81710.1| 300|Caenorhabditis elegans Hypothetical protein F35C8.5 protein. Length = 300 Score = 27.9 bits (59), Expect = 8.5 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = -1 Query: 633 SFLQTVDYLFPHGCLSYISWYCV 565 +F+ T+ ++FP CL+Y W+ + Sbjct: 190 TFITTIPWIFPTHCLTYWIWFFI 212 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,139,190 Number of Sequences: 27780 Number of extensions: 334013 Number of successful extensions: 853 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 834 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 853 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1861650246 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -