BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0943 (700 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 29 0.11 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 25 3.0 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 29.5 bits (63), Expect = 0.11 Identities = 18/56 (32%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = -1 Query: 469 GPSIQINNAARRPQLQCVLCGQVSETFRATFNFCNKC--SFNKRQSEPIEHTAAGD 308 G I N +P+ C +C Q+S T +T C KC S N Q P + D Sbjct: 1151 GSKTPILNRKEKPK-SCSVCRQISPTVNSTEPVCVKCRKSGNSHQEVPADELMKKD 1205 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 24.6 bits (51), Expect = 3.0 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 491 IKKVVCTILKCRRIVPQSSV 550 +K+ T+LK RR+ PQ +V Sbjct: 732 LKEAKMTLLKARRVAPQDTV 751 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 624,192 Number of Sequences: 2352 Number of extensions: 10662 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -