BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0939 (673 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 24 3.8 AY578798-1|AAT07303.1| 356|Anopheles gambiae baboon protein. 23 8.8 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 24.2 bits (50), Expect = 3.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -2 Query: 345 QAAGTKWIYTCIAD 304 +A G+KWI+ C AD Sbjct: 746 KAIGSKWIFNCKAD 759 >AY578798-1|AAT07303.1| 356|Anopheles gambiae baboon protein. Length = 356 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/34 (23%), Positives = 20/34 (58%) Frame = +2 Query: 107 QRLRSAPCIVVLHEQR*PLSIRWVVCSSVYKGNK 208 +++R A +V + + R + RW+ C +++ +K Sbjct: 296 RKVRLAARVVCVDQHRPSIPSRWIACDTLHAISK 329 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 664,644 Number of Sequences: 2352 Number of extensions: 14082 Number of successful extensions: 25 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -