BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0938 (746 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 25 0.49 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 21 7.9 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 25.4 bits (53), Expect = 0.49 Identities = 18/71 (25%), Positives = 35/71 (49%) Frame = +3 Query: 405 LCISSEIFDNFIDNLTDTIQMATDSQLKTLFYSLNMWPETASIRTRNYIEVWAALDDECL 584 L + +I+ + +D LTD ++ L + +L W +T S WA ++ + Sbjct: 346 LQVLEDIYSDLLD-LTDNNELF---HLGSDEVNLTCWQDTKSANKIAMKLFWAQYTNKMI 401 Query: 585 KRLKNWSHDEM 617 RLKN +++E+ Sbjct: 402 DRLKNANNNEL 412 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/26 (26%), Positives = 16/26 (61%) Frame = -1 Query: 371 EYFKNFLGCFLSPIFFI*SLKLFLRY 294 EYF+N++ F + ++ + + +RY Sbjct: 153 EYFQNYIHFFYQLLLYLITDMILMRY 178 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,069 Number of Sequences: 336 Number of extensions: 4124 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19923648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -