BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0932 (707 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222298-1|ABN79658.1| 120|Tribolium castaneum ion transport pe... 22 5.6 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 22 5.6 >EF222298-1|ABN79658.1| 120|Tribolium castaneum ion transport peptide isoform B protein. Length = 120 Score = 21.8 bits (44), Expect = 5.6 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = -1 Query: 119 VFDTCLSSATKGSSTLCLLLWQEPTLSNATASKTF 15 V+D + + C +L++EP L N S+ F Sbjct: 56 VYDKSIFAKLDSICEDCYMLFREPQLHNLCRSECF 90 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.8 bits (44), Expect = 5.6 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -2 Query: 253 SSRSCSLQVCRHLRLFAALL 194 + ++C++ + HL LFA LL Sbjct: 38 TDKNCTIVIIFHLILFAVLL 57 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.314 0.131 0.379 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,982 Number of Sequences: 336 Number of extensions: 2925 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18738900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits)
- SilkBase 1999-2023 -