BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0931 (585 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 6.7 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 21 8.9 DQ384991-1|ABD51779.1| 94|Apis mellifera allergen Api m 6 vari... 21 8.9 DQ384990-1|ABD51778.1| 92|Apis mellifera allergen Api m 6 vari... 21 8.9 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 21 8.9 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 21 8.9 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.4 bits (43), Expect = 6.7 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = -2 Query: 185 QHATHRSFCQQCPFDRRSSDF 123 +H C+ CP +SSD+ Sbjct: 271 KHEAGSHSCEACPAHSKSSDY 291 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 21.0 bits (42), Expect = 8.9 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -3 Query: 361 GSRWPGPAT 335 G RWPG AT Sbjct: 90 GMRWPGDAT 98 >DQ384991-1|ABD51779.1| 94|Apis mellifera allergen Api m 6 variant 2 precursor protein. Length = 94 Score = 21.0 bits (42), Expect = 8.9 Identities = 9/31 (29%), Positives = 14/31 (45%) Frame = +1 Query: 145 KGHC*QKDRCVACCTCAARGCRSSVPRELCV 237 +G C + C R C + VP+ LC+ Sbjct: 34 RGKCPSNEIFSRCDGRCQRFCPNVVPKPLCI 64 >DQ384990-1|ABD51778.1| 92|Apis mellifera allergen Api m 6 variant 1 precursor protein. Length = 92 Score = 21.0 bits (42), Expect = 8.9 Identities = 9/31 (29%), Positives = 14/31 (45%) Frame = +1 Query: 145 KGHC*QKDRCVACCTCAARGCRSSVPRELCV 237 +G C + C R C + VP+ LC+ Sbjct: 34 RGKCPSNEIFSRCDGRCQRFCPNVVPKPLCI 64 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.0 bits (42), Expect = 8.9 Identities = 10/29 (34%), Positives = 12/29 (41%) Frame = -2 Query: 353 VAWASDVSHAAFLASLIAFLRVSASWRRL 267 VAWA + H L L + A W L Sbjct: 246 VAWAKHIPHFTSLPLEDQVLLLRAGWNEL 274 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.0 bits (42), Expect = 8.9 Identities = 10/29 (34%), Positives = 12/29 (41%) Frame = -2 Query: 353 VAWASDVSHAAFLASLIAFLRVSASWRRL 267 VAWA + H L L + A W L Sbjct: 246 VAWAKHIPHFTSLPLEDQVLLLRAGWNEL 274 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,972 Number of Sequences: 438 Number of extensions: 3085 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16993167 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -