BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0928 (711 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_06_0008 - 9533424-9533475,9533526-9535344,9535599-9536364,955... 29 4.8 04_03_0329 - 14454840-14454862,14483886-14485630,14485843-14486648 28 6.4 03_02_1029 - 13488535-13493037 28 6.4 >10_06_0008 - 9533424-9533475,9533526-9535344,9535599-9536364, 9551969-9552097 Length = 921 Score = 28.7 bits (61), Expect = 4.8 Identities = 21/78 (26%), Positives = 30/78 (38%) Frame = +1 Query: 469 DPHPPSGRARPRPDATDHYLTRXXXXXXXFTH*GLGHTDNPTKRSM*RRGKTSSKLARLL 648 +P PP P P T+ LT+ + L H NP + + SKLA L Sbjct: 337 NPPPPPPPPPPPPPDTNAILTQILAQQANMMNAFLHHLQNPPQHNAPPPPPQHSKLAEFL 396 Query: 649 LVLKP*HQPTTDPPVHLD 702 + P + +P LD Sbjct: 397 RIRPPTFSSSNNPVDALD 414 >04_03_0329 - 14454840-14454862,14483886-14485630,14485843-14486648 Length = 857 Score = 28.3 bits (60), Expect = 6.4 Identities = 20/78 (25%), Positives = 31/78 (39%) Frame = +1 Query: 469 DPHPPSGRARPRPDATDHYLTRXXXXXXXFTH*GLGHTDNPTKRSM*RRGKTSSKLARLL 648 +P+P P P T+ LT+ + L H NP +++ SKLA L Sbjct: 302 NPNPQGNPPPPPPPDTNAILTQILAQQANMMNTFLHHLQNPPQQNAPPPPPQHSKLAEFL 361 Query: 649 LVLKP*HQPTTDPPVHLD 702 + P + +P LD Sbjct: 362 RIRPPTFSSSNNPVDALD 379 >03_02_1029 - 13488535-13493037 Length = 1500 Score = 28.3 bits (60), Expect = 6.4 Identities = 20/78 (25%), Positives = 31/78 (39%) Frame = +1 Query: 469 DPHPPSGRARPRPDATDHYLTRXXXXXXXFTH*GLGHTDNPTKRSM*RRGKTSSKLARLL 648 +P+P P P T+ LT+ + L H NP +++ SKLA L Sbjct: 20 NPNPQGNPPPPPPPDTNAILTQILAQQANMMNAFLHHLQNPPQQNAPPPPPQHSKLAEFL 79 Query: 649 LVLKP*HQPTTDPPVHLD 702 + P + +P LD Sbjct: 80 RIRPPTFSSSNNPVDALD 97 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,602,825 Number of Sequences: 37544 Number of extensions: 258010 Number of successful extensions: 603 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 603 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1839213168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -