BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0922 (706 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 28 0.085 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 23 2.4 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 3.2 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 27.9 bits (59), Expect = 0.085 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = +3 Query: 213 SLPAALGRVTPHYHGRS*RRDPQPPT*EGTRLRRHPQPRAKIFASPTDS 359 ++P L + PHY+ PQ P + T+ P P K+ S T S Sbjct: 15 NVPVVLDVIPPHYNIHHGATPPQSPNQQYTKDCSSPTPSDKLNTSTTSS 63 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 23.0 bits (47), Expect = 2.4 Identities = 11/45 (24%), Positives = 26/45 (57%), Gaps = 3/45 (6%) Frame = +1 Query: 409 AVWKEADVIGIHKPGKPTN---ETSSYRPISLLSTIGKIYERLLR 534 AV++ ++G+H+PG + TS+ + I+L + + + ++ R Sbjct: 192 AVYEPVRIMGVHRPGFDNDCNKNTSTSKEIALNNDVLLFFVKVFR 236 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.6 bits (46), Expect = 3.2 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +1 Query: 421 EADVIGIHKPGKPTNETSSYRPISL 495 ++DV+ + KPG P + P+ L Sbjct: 220 DSDVVNLSKPGTPPSGEPGNGPLDL 244 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,612 Number of Sequences: 336 Number of extensions: 3573 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18634795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -