BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0922 (706 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19G7.05c |bgs1|cps1, drc1|1,3-beta-glucan synthase catalytic... 27 2.6 SPBC21C3.02c |sds3||Sds3-like family protein|Schizosaccharomyces... 26 4.6 SPBC1539.09c |trp1||anthranilate synthase component II|Schizosac... 25 8.0 >SPBC19G7.05c |bgs1|cps1, drc1|1,3-beta-glucan synthase catalytic subunit Bgs1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1729 Score = 27.1 bits (57), Expect = 2.6 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 Query: 335 FSARLWMPSEPGAFLGWRLWIASLTS 258 F+A S+ GAF+ W LWI L + Sbjct: 490 FTANFTPTSKTGAFVSWCLWITVLVA 515 >SPBC21C3.02c |sds3||Sds3-like family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 491 Score = 26.2 bits (55), Expect = 4.6 Identities = 27/108 (25%), Positives = 40/108 (37%) Frame = +1 Query: 175 EHTELVDREVERRASLPPSDALPPITTDEVRDAIHNLQPRKAPGSDGIHNRALKFLPVQL 354 EH E++ E R + D + D VR A NL ++ + + K QL Sbjct: 336 EHEEMIQNETHERFNAC-IDLITERRDDRVRLATENLM-KQLGNIKNVMDYVTKQRKYQL 393 Query: 355 IAMLATILNAAMTHCIFPAVWKEADVIGIHKPGKPTNETSSYRPISLL 498 + I A +T +H P T +T SYR +LL Sbjct: 394 LFDKRRIRQALLTKIATKCFQLLNKQKSVHDPTYITQKTMSYRQSALL 441 >SPBC1539.09c |trp1||anthranilate synthase component II|Schizosaccharomyces pombe|chr 2|||Manual Length = 759 Score = 25.4 bits (53), Expect = 8.0 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = +1 Query: 382 AAMTHCIFPAVWKEADVIGIHKPGKPTNETSSYRPISLLSTIGKIY 519 +++ C+ W E VI + K E Y P S+LS GK Y Sbjct: 164 SSLPDCLDVTSWTENGVIMGARHKKYAIEGVQYHPESILSEYGKEY 209 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,818,238 Number of Sequences: 5004 Number of extensions: 57417 Number of successful extensions: 164 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 160 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 164 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 327172622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -