BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0922 (706 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 2.8 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 21 8.6 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 8.6 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 8.6 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 Query: 436 GIHKPGKPTNETSSYRPISLLST 504 G KP KP + ++S P S+ S+ Sbjct: 585 GTEKPDKPASSSASSAPTSVCSS 607 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +1 Query: 196 REVERRASLPPSDAL 240 RE+E+R S+P +D L Sbjct: 397 REMEKRQSVPANDLL 411 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.4 bits (43), Expect = 8.6 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +1 Query: 190 VDREVERRASLPPSDALPPITTDEVRDAIHNLQP 291 +++ ER L SDAL I + +HN P Sbjct: 442 LEKTYERDTCLLASDALKQILSAAYNVELHNSSP 475 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.4 bits (43), Expect = 8.6 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +1 Query: 190 VDREVERRASLPPSDALPPITTDEVRDAIHNLQP 291 +++ ER L SDAL I + +HN P Sbjct: 480 LEKTYERDTCLLASDALKQILSAAYNVELHNSSP 513 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,727 Number of Sequences: 438 Number of extensions: 4598 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -