BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0921 (734 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPMIT.04 |cox3||cytochrome c oxidase 3|Schizosaccharomyces pombe... 30 0.39 SPAC17A2.06c |vps8||WD repeat protein Vps8|Schizosaccharomyces p... 29 0.91 SPAC16E8.04c |||chorismate mutase |Schizosaccharomyces pombe|chr... 27 3.7 SPBC83.11 |||triose phosphate transporter|Schizosaccharomyces po... 26 6.4 >SPMIT.04 |cox3||cytochrome c oxidase 3|Schizosaccharomyces pombe|chr mitochondrial|||Manual Length = 273 Score = 29.9 bits (64), Expect = 0.39 Identities = 14/57 (24%), Positives = 28/57 (49%) Frame = +1 Query: 256 MLMFFLNVA*NIIVNGVSHYFKYFMFSLMQLIVTFFLYFVSHCVHLNLQNVLFKCLT 426 +++FF +A + ++G H +F S + L+ T +L+F N+ K +T Sbjct: 30 VVLFFNCLAATLYLHGYKHSSVFFGISFLGLLATMYLWFRDMSTEANIHGAHTKAVT 86 >SPAC17A2.06c |vps8||WD repeat protein Vps8|Schizosaccharomyces pombe|chr 1|||Manual Length = 1272 Score = 28.7 bits (61), Expect = 0.91 Identities = 20/90 (22%), Positives = 49/90 (54%), Gaps = 5/90 (5%) Frame = +3 Query: 465 LYWHISS--VTIVFTSFELSLLNPNNLNVFSIIYSYLLNNVIMYL*YYNNVIDVLRIVTT 638 L+W SS + I+F EL+ +N +L++ S +L+ ++ +Y+N + + + T Sbjct: 357 LWWFPSSSIIIILFDDMELAFVNSMSLDIIGT--STILDKSLLRWDWYSNSLAAIGVSQT 414 Query: 639 V--YVISEIEINFNY-FIERNKNLFINTYV 719 V ++ S + I+ Y F+ ++ + + +++ Sbjct: 415 VFPFISSSLCISPRYMFVVNSETVSVGSFL 444 >SPAC16E8.04c |||chorismate mutase |Schizosaccharomyces pombe|chr 1|||Manual Length = 251 Score = 26.6 bits (56), Expect = 3.7 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +3 Query: 522 LNPNNLNVFSIIYSYLLNNVI 584 L+PNN+NV S I Y +N ++ Sbjct: 102 LHPNNVNVNSEILEYYINEIV 122 >SPBC83.11 |||triose phosphate transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 434 Score = 25.8 bits (54), Expect = 6.4 Identities = 10/23 (43%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = +1 Query: 286 NIIVNGVSHYFKYFM-FSLMQLI 351 N+I NG+SH+F+ + F+L+ +I Sbjct: 227 NLIYNGLSHFFQNILAFTLLSII 249 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,736,606 Number of Sequences: 5004 Number of extensions: 53556 Number of successful extensions: 107 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 107 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 347244562 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -