BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0921 (734 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0045 + 314151-314323,314426-314488,314568-314684,314773-31... 29 3.8 03_05_0092 - 20714102-20717902 29 5.1 >05_01_0045 + 314151-314323,314426-314488,314568-314684,314773-314887, 315013-315171,315612-315716,315818-316081 Length = 331 Score = 29.1 bits (62), Expect = 3.8 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +1 Query: 334 SLMQLIVTFFLYFVSHCVHLNLQNVLFKCLTST 432 SLM LI FF F+ + LNL NV K ++T Sbjct: 65 SLMLLIKLFFCAFIGNTFSLNLYNVSMKFTSAT 97 >03_05_0092 - 20714102-20717902 Length = 1266 Score = 28.7 bits (61), Expect = 5.1 Identities = 16/24 (66%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = +3 Query: 348 DCDVLLV--FCQSLRSLESSECFI 413 DC LLV F SLR LE SECFI Sbjct: 1057 DCPKLLVDKFHTSLRKLEISECFI 1080 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,318,797 Number of Sequences: 37544 Number of extensions: 261409 Number of successful extensions: 608 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 594 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 608 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1933531792 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -