BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0917 (686 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 28 0.24 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 27 0.55 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 26 1.3 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 25 1.7 AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox prote... 25 3.0 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 24 3.9 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 5.2 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 24 5.2 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 23 9.0 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 23 9.0 AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 23 9.0 AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A... 23 9.0 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 28.3 bits (60), Expect = 0.24 Identities = 16/50 (32%), Positives = 20/50 (40%) Frame = +1 Query: 448 QPLPHRVPVQGDGGQGLRHPVQPRGRAQGHVLPPHRHVEGDPAAAHRRPL 597 QP P P Q +HP GR+ + PP H + AAH L Sbjct: 829 QPPPGSHPGAQTQPQLSQHPPGASGRSSAVITPPSTHHQAAAVAAHHHHL 878 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 27.1 bits (57), Expect = 0.55 Identities = 15/58 (25%), Positives = 25/58 (43%) Frame = +2 Query: 242 YAPDAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGEFVVSTRV 415 + P+ Y+ A L+DP I ++ K P + + +DP GEF + V Sbjct: 2685 WEPETGLYNYRARLYDPDIGRFYQMDPKEQYPSPYVYAGNSPVSLIDPDGEFAFTLAV 2742 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +1 Query: 22 KCQKSRNNGRRRNPREIGGW 81 K SR N RRR+PR G W Sbjct: 249 KIPPSRRNPRRRSPRSGGRW 268 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 25.4 bits (53), Expect = 1.7 Identities = 12/52 (23%), Positives = 24/52 (46%) Frame = +2 Query: 467 SQYKEMEDKVSGTLSSLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRF 622 +++ ++D++S +L SLE + T E Q + + F + D F Sbjct: 684 TRFSNLQDQLSNSLMSLECDALATKLKPNNYEYERNQNIYNSQFKVEYSDNF 735 >AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox protein protein. Length = 338 Score = 24.6 bits (51), Expect = 3.0 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -3 Query: 444 GYPSSERPQRTRVETTNSPAGSR 376 G S + PQR+ + T+SP GS+ Sbjct: 300 GSDSEDLPQRSAEDRTHSPVGSQ 322 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 24.2 bits (50), Expect = 3.9 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +3 Query: 12 TVVQVPEKPQQWSTPQPSRNWRLVSASSRDPTLSRC*RSTL 134 T+ +V +P+ S PS NWRL+ + LS RSTL Sbjct: 921 TMTEVLLEPKV-SLENPSVNWRLLWRNIHRSCLSSLQRSTL 960 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.8 bits (49), Expect = 5.2 Identities = 13/51 (25%), Positives = 22/51 (43%) Frame = +2 Query: 242 YAPDAESYSVFAELFDPIIEDYHNGFKKTDKHPPKNWGDVDTLGNLDPAGE 394 + P+ Y+ A L+DP I ++ K P + + +DP GE Sbjct: 2675 WEPETGLYNYRARLYDPDIGRFYQMDPKEQYPSPYVYAGNSPVSLIDPDGE 2725 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/42 (28%), Positives = 20/42 (47%), Gaps = 4/42 (9%) Frame = +1 Query: 505 PVQPRGRAQGHVLPPHRHVEGDPAAAH----RRPLPVQGGRP 618 P P G + + P + ++ G + R P+P+QGG P Sbjct: 268 PPNPMGGPRPQISPQNSNLSGGMPSGMVGPPRPPMPMQGGAP 309 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.0 bits (47), Expect = 9.0 Identities = 13/45 (28%), Positives = 16/45 (35%) Frame = +1 Query: 439 VPLQPLPHRVPVQGDGGQGLRHPVQPRGRAQGHVLPPHRHVEGDP 573 VP+ PL + G G P H LP H H + P Sbjct: 69 VPISPLHIKQEPLGSDGPMPAQPPHHHQHPHHHQLPHHPHHQHHP 113 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.0 bits (47), Expect = 9.0 Identities = 13/45 (28%), Positives = 16/45 (35%) Frame = +1 Query: 439 VPLQPLPHRVPVQGDGGQGLRHPVQPRGRAQGHVLPPHRHVEGDP 573 VP+ PL + G G P H LP H H + P Sbjct: 69 VPISPLHIKQEPLGSDGPMPAQPPHHHQHPHHHQLPHHPHHQHHP 113 >AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. Length = 506 Score = 23.0 bits (47), Expect = 9.0 Identities = 8/35 (22%), Positives = 21/35 (60%) Frame = -3 Query: 273 NTEYDSASGA*IPTPESKFSTPDWMQSRRVDPNEV 169 NT+Y++ + + +P+ T +Q +++ PN++ Sbjct: 187 NTQYNALNDNYVTSPQPSQVTSRQLQQQQLQPNQL 221 >AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A2 protein. Length = 496 Score = 23.0 bits (47), Expect = 9.0 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +2 Query: 302 DYHNGFKKTDKHPPKNWG 355 D HN K ++PPK++G Sbjct: 448 DLHNQSVKAMRYPPKSYG 465 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 598,892 Number of Sequences: 2352 Number of extensions: 12938 Number of successful extensions: 49 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -