BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0914 (680 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 25 0.51 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 23 2.7 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 23 2.7 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 4.7 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 22 6.2 AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 22 6.2 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 6.2 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 8.2 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 8.2 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 8.2 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 25.4 bits (53), Expect = 0.51 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = +1 Query: 400 PSLRRGRCPTPSRERERCPSHRPVPFARRSRTRAKKPTRRKSRK 531 P + R P+ ERE S +P P S++ R++S K Sbjct: 341 PCILRMSRPSDKEEREAQKSQKPSPVTGASKSHGDLELRQRSSK 384 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -3 Query: 633 YTKLTNNPYSTPIQYLESVSRG 568 Y ++ +P TP Q+ +SVS G Sbjct: 408 YQTMSRDPARTPFQWDDSVSAG 429 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -3 Query: 633 YTKLTNNPYSTPIQYLESVSRG 568 Y ++ +P TP Q+ +SVS G Sbjct: 408 YQTMSRDPARTPFQWDDSVSAG 429 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 22.2 bits (45), Expect = 4.7 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = +3 Query: 390 GVLTITAPRKVPDAVKGERKVPIAQTGPVRKEIKDQSEEAN 512 G T T D + E +PI +TG K I ++ E N Sbjct: 141 GKSTTTTVEVKRDIINPEDVIPIRRTGEGSKPIFEREEIKN 181 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 6.2 Identities = 15/49 (30%), Positives = 21/49 (42%) Frame = +3 Query: 366 VESRLSSDGVLTITAPRKVPDAVKGERKVPIAQTGPVRKEIKDQSEEAN 512 +E R G TIT D + E + I +TG K I ++ E N Sbjct: 133 LEIRRDLPGKSTITTVEVKRDIINPEDVILIRRTGEGSKPIFEREEIKN 181 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 21.8 bits (44), Expect = 6.2 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +2 Query: 551 YYKMAVPRETDSKYCIGVL 607 Y+K+ V + DS C G L Sbjct: 187 YFKVVVVEDVDSVECCGAL 205 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.8 bits (44), Expect = 6.2 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = +3 Query: 552 ITKWRCHERLIPNIV*VCYKGYL 620 + W H+R +PN + + K +L Sbjct: 800 VKTWIAHDRYLPNSLRILLKRFL 822 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 8.2 Identities = 13/57 (22%), Positives = 25/57 (43%) Frame = +3 Query: 9 DFGSRRPRRLLDQHFGLALTPDDLLSVAAGPLLNREYYRPWRHLAAAARDVGSSIKV 179 D G D + L + L+V A P+L + + ++L R+ G++ K+ Sbjct: 329 DLGKLGEEEKADWWKDIMLLNEKTLAVPAPPVLPENHLKNAKYLDVIERNSGATDKI 385 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 8.2 Identities = 13/57 (22%), Positives = 25/57 (43%) Frame = +3 Query: 9 DFGSRRPRRLLDQHFGLALTPDDLLSVAAGPLLNREYYRPWRHLAAAARDVGSSIKV 179 D G D + L + L+V A P+L + + ++L R+ G++ K+ Sbjct: 329 DLGKLGEEEKADWWKDIMLLNEKTLAVPAPPVLPENHLKNAKYLDVIERNSGATDKI 385 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 8.2 Identities = 13/57 (22%), Positives = 25/57 (43%) Frame = +3 Query: 9 DFGSRRPRRLLDQHFGLALTPDDLLSVAAGPLLNREYYRPWRHLAAAARDVGSSIKV 179 D G D + L + L+V A P+L + + ++L R+ G++ K+ Sbjct: 329 DLGKLGEEEKADWWKDIMLLNEKTLAVPAPPVLPENHLKNAKYLDVIERNSGATDKI 385 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,744 Number of Sequences: 438 Number of extensions: 3500 Number of successful extensions: 11 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -