BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0908 (705 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26768| Best HMM Match : PCI (HMM E-Value=0.01) 122 4e-28 SB_59548| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_34040| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_28916| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 >SB_26768| Best HMM Match : PCI (HMM E-Value=0.01) Length = 266 Score = 122 bits (293), Expect = 4e-28 Identities = 80/192 (41%), Positives = 115/192 (59%), Gaps = 11/192 (5%) Frame = +1 Query: 163 NHPLEQFVLLAKGAKGSACAELIKQVLEAPGVHVFGELLEMPNIKELESGPYATHLKTLN 342 +H LEQ+VLLAK A+G+A LIKQVLEAP ++VFGEL+EM NI+EL A + LN Sbjct: 10 SHQLEQYVLLAKSARGAALTALIKQVLEAPALYVFGELIEMSNIQELAKTENAPFWQLLN 69 Query: 343 LFAYGTY---KDYIENKSDYLE--LTTVQCKKLQHLTIA--TLATQEKCIPYSVL-LEEL 498 +FA+GTY KD + ++ + T+ L +I + T P + L L Sbjct: 70 IFAFGTYTDYKDVVALLHIHVRHHVLTLYSWMLWSYSIFLDNMGTLPPLTPVQIKKLRHL 129 Query: 499 DIKNVRDL-EDLIIEAIYADIIHGKLDQECKRVGSGTWPLAEMRGLKMQL--PLADVLAD 669 I ++ +DLIIEAIYADIIHGKLDQ+ K++ A R +K + +A++L D Sbjct: 130 TIVSLASKSKDLIIEAIYADIIHGKLDQKNKQL---EVEYAMGRDIKPETVGTIAEILQD 186 Query: 670 WCNAWEAVLNSV 705 WC + +++LNS+ Sbjct: 187 WCQSCDSILNSI 198 >SB_59548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2835 Score = 29.9 bits (64), Expect = 2.1 Identities = 22/87 (25%), Positives = 37/87 (42%) Frame = +1 Query: 82 DIDVLKFKMNPMSMDRDEPSSLLSFSSNHPLEQFVLLAKGAKGSACAELIKQVLEAPGVH 261 D+D++ + + + E S+ SS LE V K S+CA ++ + V Sbjct: 1244 DLDLVSSALKDATTETKELSATAVVSSTVSLEGIVDALK----SSCATTVRDAVARKLVQ 1299 Query: 262 VFGELLEMPNIKELESGPYATHLKTLN 342 V +LE +KE+ S +T N Sbjct: 1300 VMSNILESAGLKEMTSKTIEQERRTSN 1326 >SB_34040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 327 Score = 28.7 bits (61), Expect = 4.9 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = +1 Query: 529 LIIEAIYADIIHGKL-DQECKRVGSGTWPLAEMRGLKMQLPLADVLADWCNAWEAVLNSV 705 LII +I G+L D++C RV G AE+ + L +A+ + CN A+L+S+ Sbjct: 157 LIIWTARLMLIKGRLADRDC-RVYGGLTHTAEVLVFTITLTVAECACNQCNENSAILSSI 215 >SB_28916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 807 Score = 28.3 bits (60), Expect = 6.4 Identities = 16/44 (36%), Positives = 20/44 (45%) Frame = +1 Query: 97 KFKMNPMSMDRDEPSSLLSFSSNHPLEQFVLLAKGAKGSACAEL 228 KF +N + MDR P + F S H LA A ACA + Sbjct: 228 KFWLNFLDMDRLSPQATSRFISEHRKPGLWALANNAGYGACAPI 271 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,113,560 Number of Sequences: 59808 Number of extensions: 449715 Number of successful extensions: 1012 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 921 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1010 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -