BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0904 (354 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g25800.1 68416.m03211 serine/threonine protein phosphatase 2A... 32 0.096 At1g13320.1 68414.m01546 serine/threonine protein phosphatase 2A... 32 0.096 At1g25490.1 68414.m03165 serine/threonine protein phosphatase 2A... 31 0.22 At2g21490.1 68415.m02557 dehydrin family protein contains Pfam d... 30 0.39 At3g29320.1 68416.m03682 glucan phosphorylase, putative similar ... 29 0.89 At3g02630.1 68416.m00254 acyl-[acyl-carrier-protein] desaturase,... 28 2.1 At2g22350.1 68415.m02652 RNase H domain-containing protein low s... 27 3.6 At1g50730.1 68414.m05705 expressed protein 27 3.6 At5g26830.1 68418.m03201 threonyl-tRNA synthetase / threonine--t... 27 4.7 At5g17880.1 68418.m02097 disease resistance protein (TIR-NBS-LRR... 27 4.7 At3g51570.1 68416.m05648 disease resistance protein (TIR-NBS-LRR... 27 4.7 At1g55300.1 68414.m06317 TATA-binding protein-associated factor ... 26 8.3 >At3g25800.1 68416.m03211 serine/threonine protein phosphatase 2A (PP2A) 65 KDa regulatory subunit A identical to protein phosphatase 2A 65 kDa regulatory subunit (pDF1) GI:683502 from [Arabidopsis thaliana] Length = 587 Score = 32.3 bits (70), Expect = 0.096 Identities = 17/60 (28%), Positives = 31/60 (51%) Frame = +1 Query: 19 ANLRHLREAYESLLKLDLPSQPLSIVERVIYDYRVHGMVVFLQRALKRVKGLADKETWKI 198 A + HL + SLLK + P L+I+ ++ +V G+ + Q L + LA+ W++ Sbjct: 354 ATIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRV 413 >At1g13320.1 68414.m01546 serine/threonine protein phosphatase 2A (PP2A) 65 kDa regulatory subunit, putative similar to protein phosphatase 2A 65 kDa regulatory subunit GI:683502 from [Arabidopsis thaliana] Length = 587 Score = 32.3 bits (70), Expect = 0.096 Identities = 17/60 (28%), Positives = 31/60 (51%) Frame = +1 Query: 19 ANLRHLREAYESLLKLDLPSQPLSIVERVIYDYRVHGMVVFLQRALKRVKGLADKETWKI 198 A + HL + SLLK + P L+I+ ++ +V G+ + Q L + LA+ W++ Sbjct: 354 ATIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRV 413 >At1g25490.1 68414.m03165 serine/threonine protein phosphatase 2A (PP2A) regulatory subunit A (RCN1) identical to phosphoprotein phosphatase 2A, regulatory subunit A GI:1262171 from [Arabidopsis thaliana] Length = 588 Score = 31.1 bits (67), Expect = 0.22 Identities = 16/60 (26%), Positives = 31/60 (51%) Frame = +1 Query: 19 ANLRHLREAYESLLKLDLPSQPLSIVERVIYDYRVHGMVVFLQRALKRVKGLADKETWKI 198 + + HL + SLLK + P L+I+ ++ +V G+ + Q L + LA+ W++ Sbjct: 354 STIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRV 413 >At2g21490.1 68415.m02557 dehydrin family protein contains Pfam domain, PF00257: Dehydrin Length = 185 Score = 30.3 bits (65), Expect = 0.39 Identities = 18/66 (27%), Positives = 33/66 (50%) Frame = +3 Query: 3 AGPARCQSAAPQGSLRVSAEIGSALTATEHSGARDIRLPRARHGRVPPASSQEGQRSRRQ 182 A PA +A + VSA G+ T +H G+ + L R+ +S +GQ RR+ Sbjct: 68 AAPAGAGAATAATATGVSAGTGATTTGQQHHGSLEEHLRRSGSSS-SSSSEDDGQGGRRK 126 Query: 183 GNMEDR 200 +++++ Sbjct: 127 KSIKEK 132 >At3g29320.1 68416.m03682 glucan phosphorylase, putative similar to alpha-glucan phosphorylase, L isozyme 1 precursor GB:P04045 from [Solanum tuberosum] (J. Biochem. 106 (4), 691-695 (1989)) Length = 962 Score = 29.1 bits (62), Expect = 0.89 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +1 Query: 142 LQRALKRVKGLADKETWKIEEFT-EYGAITKLPHLLETYVKEALSDI 279 L R L +KGL+ ++ WKI + T Y T LP LE + E + + Sbjct: 415 LMRILMDLKGLSWEDAWKITQRTVAYTNHTVLPEALEKWSLELMEKL 461 >At3g02630.1 68416.m00254 acyl-[acyl-carrier-protein] desaturase, putative / stearoyl-ACP desaturase, putative similar to Acyl-[acyl-carrier protein] desaturase from Sesamum indicum GI:575942, Cucumis sativus SP|P32061, Ricinus communis SP|P22337; contains Pfam profile PF03405 Fatty acid desaturase Length = 396 Score = 27.9 bits (59), Expect = 2.1 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -3 Query: 136 RPCRARGSRISRAPLCSVAVRADPISAETRRL 41 RPC+ARGSR SR + S A R+L Sbjct: 18 RPCQARGSRSSRVSMASTIRSATTEVTNGRKL 49 >At2g22350.1 68415.m02652 RNase H domain-containing protein low similarity to reverse transcriptase [Arabidopsis thaliana] GI:976278; contains Pfam profile PF00075: RNase H Length = 321 Score = 27.1 bits (57), Expect = 3.6 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 76 SQPLSIVERVIYDYRVHGMVVFLQRALKRVKGLAD 180 S PLS + R+ YD+ G +V + + LAD Sbjct: 245 SHPLSFLLRLCYDFLSKGWIVRISHVYREANRLAD 279 >At1g50730.1 68414.m05705 expressed protein Length = 1013 Score = 27.1 bits (57), Expect = 3.6 Identities = 17/57 (29%), Positives = 29/57 (50%) Frame = +1 Query: 154 LKRVKGLADKETWKIEEFTEYGAITKLPHLLETYVKEALSDIHKCVWCGGRRESAAL 324 +K +K + D + + Y IT LL + V+ A+ I KC++ GR+E+ L Sbjct: 338 IKCIKDIEDVLAPVLVDKEGYSYITDDKKLLFSLVEPAIEYIMKCLFLTGRQENNVL 394 >At5g26830.1 68418.m03201 threonyl-tRNA synthetase / threonine--tRNA ligase (THRRS) identical to SP|O04630 Threonyl-tRNA synthetase, mitochondrial precursor (EC 6.1.1.3) (Threonine--tRNA ligase) (ThrRS) {Arabidopsis thaliana} Length = 709 Score = 26.6 bits (56), Expect = 4.7 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +1 Query: 91 IVERVIYDYRVHGMVVFLQRALKRVKGLADKETW 192 ++E + Y Y+V G L+ + + K L D ETW Sbjct: 473 VLEFIDYVYKVFGFTYELKLSTRPEKYLGDLETW 506 >At5g17880.1 68418.m02097 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1197 Score = 26.6 bits (56), Expect = 4.7 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +3 Query: 177 RQGNMEDRRV-HRIWSHH*TASSIRDVREGGA 269 R+ DR+ HR+W HH T ++ D +GG+ Sbjct: 525 REATATDRKGRHRLWHHH-TIIAVLDKNKGGS 555 >At3g51570.1 68416.m05648 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1226 Score = 26.6 bits (56), Expect = 4.7 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +3 Query: 174 RRQGNMEDRRVHRIWSHH*TASSIRDVREGGAV 272 RR + R HR+W H ++++ EG V Sbjct: 517 RRAYAQDGREPHRLWHHQDITDVLKNIEEGAEV 549 >At1g55300.1 68414.m06317 TATA-binding protein-associated factor TAFII55 family protein contains Pfam profile: PF04658 TAFII55 protein conserved region Length = 203 Score = 25.8 bits (54), Expect = 8.3 Identities = 15/54 (27%), Positives = 23/54 (42%) Frame = +3 Query: 54 SAEIGSALTATEHSGARDIRLPRARHGRVPPASSQEGQRSRRQGNMEDRRVHRI 215 +A+IG + E G RHG PP +R RR+ ++ V R+ Sbjct: 78 TADIGQMIMVRE-PGDPAPNTVEYRHGLTPPMKDARKRRFRREPDLNPELVQRV 130 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,365,395 Number of Sequences: 28952 Number of extensions: 122129 Number of successful extensions: 421 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 415 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 420 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 449370720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -