BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0903 (505 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 27 0.27 AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase p... 27 0.36 AY752910-1|AAV30084.1| 250|Anopheles gambiae peroxidase 15 prot... 24 3.4 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 7.8 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 27.5 bits (58), Expect = 0.27 Identities = 19/92 (20%), Positives = 37/92 (40%), Gaps = 6/92 (6%) Frame = +1 Query: 154 VPTPSNNKDGSTISELPENWDQTKDDN-RSLFLNKSDK-----NDLEPYPLALSEEGNQD 315 VP + D S I +LP W++ N R+ ++N K EP + + GN + Sbjct: 148 VPEDDDAADESMIHQLPRGWEERSAQNGRTYYVNHYTKTTQWSRPTEPAGPPVRQSGNNN 207 Query: 316 GYDQTVDQRFDSPQSNGELDNLIMRPELYGEP 411 + + + + G + + + + G P Sbjct: 208 AANSSTPLTVNGTVNGGGVPHPQQQQHILGSP 239 >AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase protein. Length = 687 Score = 27.1 bits (57), Expect = 0.36 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +1 Query: 121 TAITAVLAVSAVPTPSNNKDGSTISELPENW--DQTKDDNRSLFLNKSDKND 270 T + A+L PT DG T+ +LPEN+ D+ K +SL S + D Sbjct: 5 TKLLALLQRPLEPTFYPKDDGKTVVDLPENYLTDRYKPIGQSLQTRFSSEAD 56 >AY752910-1|AAV30084.1| 250|Anopheles gambiae peroxidase 15 protein. Length = 250 Score = 23.8 bits (49), Expect = 3.4 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 262 KNDLEPYPLALSEEGNQDGYDQTVD 336 K +E + L +EG DGYD+ ++ Sbjct: 101 KEVMEKFGLLTPKEGYWDGYDENIN 125 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 22.6 bits (46), Expect = 7.8 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = +1 Query: 148 SAVPTPSNNKDGSTISELPENWDQTKDDNRSLFLNKSDKNDLEPYPLALSEEGNQDG 318 S+ T +NN+DG I++ ++ D T S L + DL+P + EG+ G Sbjct: 3051 SSTTTTTNNRDGGLIAD-SQSADLTL---TSCTLADAGSVDLQPPATPVGREGSGIG 3103 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 544,846 Number of Sequences: 2352 Number of extensions: 10439 Number of successful extensions: 12 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45245913 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -