BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0902 (463 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 22 2.4 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 21 5.6 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 5.6 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 20 9.7 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 22.2 bits (45), Expect = 2.4 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = -1 Query: 340 ILTFI-SWMLSALAVTRLQQFLVTHREWWXALDAQRSFVNPLVAVLD*LKDVFLEENN 170 I++F+ S L AVT + L+ ++E W +L+ F++ + + VF E N Sbjct: 18 IVSFVNSIFLVMSAVTIILSSLIFNQEQWSSLNKNFQFIDKKLNNRNSKSRVFYENVN 75 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 21.0 bits (42), Expect = 5.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -2 Query: 258 GXRWMLNDPLSTH 220 G R+++ND LS H Sbjct: 134 GFRYLVNDELSAH 146 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.0 bits (42), Expect = 5.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -2 Query: 258 GXRWMLNDPLSTH 220 G R+++ND LS H Sbjct: 448 GFRYLVNDELSAH 460 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 20.2 bits (40), Expect = 9.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +1 Query: 304 PGHLTSMK*KLGCGTS 351 PG L SM + CGTS Sbjct: 216 PGSLGSMGVSVPCGTS 231 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 98,883 Number of Sequences: 336 Number of extensions: 1994 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10616413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -