BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0902 (463 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51630| Best HMM Match : Fz (HMM E-Value=3.3e-34) 32 0.27 SB_35254| Best HMM Match : Vicilin_N (HMM E-Value=0.066) 29 1.9 SB_28806| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_15022| Best HMM Match : Zona_pellucida (HMM E-Value=5.6e-38) 27 5.7 SB_24442| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_55250| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 10.0 SB_57763| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 10.0 >SB_51630| Best HMM Match : Fz (HMM E-Value=3.3e-34) Length = 1120 Score = 31.9 bits (69), Expect = 0.27 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 4/56 (7%) Frame = -3 Query: 416 PLAID--LLHPSPA-SERRKHEL-KRLVPHPNFYFMDVKCPGCYKITTVFSHAQRV 261 PL D L H P S R K + KR P P ++K P Y++TT+ +H+ RV Sbjct: 404 PLTRDPTLTHSVPIISGRLKTSMNKRTKPKPGERATEIKSPSTYQVTTMVTHSPRV 459 >SB_35254| Best HMM Match : Vicilin_N (HMM E-Value=0.066) Length = 909 Score = 29.1 bits (62), Expect = 1.9 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 4/76 (5%) Frame = +3 Query: 246 SSAXHHSLCVTKNCCNLVTARALNIHEIKVRMWH-*PLKLMF---PPLRRRGRMQQINCE 413 SS H S CVT L++ ALN K + + ++L F PP R+ R + N Sbjct: 102 SSLVHSSHCVTSTTMRLISQHALNKVTYKASLLNDFTVELGFYDMPPEERKHRKIETNVF 161 Query: 414 RHGYSFNAQPEKKKKK 461 R + A ++K+K Sbjct: 162 RFNHPKEAAELREKRK 177 >SB_28806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 614 Score = 27.5 bits (58), Expect = 5.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -3 Query: 314 KCPGCYKITTVFSHAQRVVVCAGC 243 +CP CY ++ V + Q V C+ C Sbjct: 208 RCPRCYPMSKVLPNVQGVTQCSRC 231 >SB_15022| Best HMM Match : Zona_pellucida (HMM E-Value=5.6e-38) Length = 525 Score = 27.5 bits (58), Expect = 5.7 Identities = 8/25 (32%), Positives = 18/25 (72%) Frame = -3 Query: 245 CSTILCQPTGGRARLTEGCFFRRKQ 171 C ++CQ + ++R T+GC ++R++ Sbjct: 230 CEVLVCQRSDKKSRCTKGCPYQRRR 254 >SB_24442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 673 Score = 27.5 bits (58), Expect = 5.7 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 258 HHSLCVTKNCCNLVTARALNIHEIKVR 338 HHS+ + K C VT+ +L+ H K R Sbjct: 201 HHSMNLEKKCATRVTSESLDSHSSKDR 227 >SB_55250| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 360 Score = 26.6 bits (56), Expect = 10.0 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 3/42 (7%) Frame = -3 Query: 446 FRLCIKAVTMPLAIDLLHPSPASERRKHELKR---LVPHPNF 330 F+L + T+ I ++ P RR+ LKR + P PNF Sbjct: 107 FQLIVTRDTIMKCIRIIDPEGVERRRRRRLKRRKYVTPGPNF 148 >SB_57763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 351 Score = 26.6 bits (56), Expect = 10.0 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 3/42 (7%) Frame = -3 Query: 446 FRLCIKAVTMPLAIDLLHPSPASERRKHELKR---LVPHPNF 330 F+L + T+ I ++ P RR+ LKR + P PNF Sbjct: 107 FQLIVTRDTIMKCIRIIDPEGVERRRRRRLKRRKYVTPGPNF 148 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,493,923 Number of Sequences: 59808 Number of extensions: 224008 Number of successful extensions: 546 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 546 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 945255773 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -