BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0902 (463 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CY... 23 3.9 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 23 5.2 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 23 5.2 EF426176-1|ABO26419.1| 155|Anopheles gambiae unknown protein. 23 6.9 DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription fact... 23 6.9 DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription fact... 23 6.9 >AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CYP6S2 protein. Length = 504 Score = 23.4 bits (48), Expect = 3.9 Identities = 15/45 (33%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 461 FFFFFFRLCIKAVTMPLAIDLL--HPSPASERRKHELKRLVPHPN 333 F FFF T+ A+ LL HP + RK L H N Sbjct: 298 FVFFFGGFETSTTTLTFALHLLAQHPKAQRKARKCVRSTLAKHGN 342 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 23.0 bits (47), Expect = 5.2 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -3 Query: 128 DFFSNCIME*YFSSSLQWIH 69 D+ +NC+ YFS +H Sbjct: 454 DYMNNCLQSGYFSGGFSSLH 473 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.0 bits (47), Expect = 5.2 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 129 RFFFQLYNGVIFFKF 85 +F FQ++NG FF F Sbjct: 1035 QFMFQIFNGERFFAF 1049 >EF426176-1|ABO26419.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 22.6 bits (46), Expect = 6.9 Identities = 11/35 (31%), Positives = 15/35 (42%) Frame = -3 Query: 302 CYKITTVFSHAQRVVVCAGCSTILCQPTGGRARLT 198 C I + R+V C C+T LC G +T Sbjct: 106 CSLIQSALPSEIRIVDCDLCTTELCNGASGITAVT 140 >DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 102 VIFFKFTTMDPFEHYK*RLF 43 V+ ++F TMD ++Y RLF Sbjct: 143 VLRYRFETMDDLQNYWDRLF 162 >DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 102 VIFFKFTTMDPFEHYK*RLF 43 V+ ++F TMD ++Y RLF Sbjct: 143 VLRYRFETMDDLQNYWDRLF 162 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 425,162 Number of Sequences: 2352 Number of extensions: 8335 Number of successful extensions: 102 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 102 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39969834 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -