BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0896 (569 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9148| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.071 SB_22474| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_15430| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_23805| Best HMM Match : Fun_ATP-synt_8 (HMM E-Value=7.1) 28 4.7 SB_12655| Best HMM Match : Astacin (HMM E-Value=0) 27 8.2 >SB_9148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 34.3 bits (75), Expect = 0.071 Identities = 20/43 (46%), Positives = 24/43 (55%), Gaps = 4/43 (9%) Frame = -1 Query: 566 YVALRFLGTNTVSAYHRARVYGLKIL----TEPFADVQDSEQG 450 Y+ LR LG N VS Y RAR+ L I+ E A + SEQG Sbjct: 61 YLCLRLLGFNIVSVYRRARITALTIIGRKPEERTASPEPSEQG 103 >SB_22474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 642 Score = 29.5 bits (63), Expect = 2.0 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = -1 Query: 518 RARVYGLKILTEPFADVQDSEQGQLSTISRTVTVEIAPKD 399 R R G +I+ + D DSE +T+SRTV IAP D Sbjct: 239 RFRRTGTRIIEQLVQDAMDSESADTATLSRTV---IAPHD 275 >SB_15430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 28.7 bits (61), Expect = 3.5 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +3 Query: 432 ADGRQLTLLRVLDVGEGLRQDLQAVDAGPVVRRHRVRAQE 551 +D R TL+RV ++G+G R + PV++ + R QE Sbjct: 99 SDQRGKTLIRVRNLGKGGRCKAALAEIDPVIQENTERVQE 138 >SB_23805| Best HMM Match : Fun_ATP-synt_8 (HMM E-Value=7.1) Length = 126 Score = 28.3 bits (60), Expect = 4.7 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +3 Query: 387 LVEDVFRCDLDGHRPADGRQLTLLRVLDVGEGLRQDLQAV 506 L++DV +C LD H G L L + G L+Q ++ V Sbjct: 80 LLQDVIKCALDTHEWTRGIYLDCLIYFESGSSLKQLMEIV 119 >SB_12655| Best HMM Match : Astacin (HMM E-Value=0) Length = 482 Score = 27.5 bits (58), Expect = 8.2 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +2 Query: 104 YSSRLYWN-EISLYNIFNIYFHRILCGVH*KFHKLTSTHY 220 Y L+WN E +N FN+Y H +L ++ + + HY Sbjct: 372 YVKILWWNIEPGFFNNFNVYSHSVLDTLNAPYDYHSLMHY 411 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,299,555 Number of Sequences: 59808 Number of extensions: 201866 Number of successful extensions: 516 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 473 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 515 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1349364063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -