BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0896 (569 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-tran... 25 1.7 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 5.3 >AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-transferase D6 protein. Length = 222 Score = 25.0 bits (52), Expect = 1.7 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -3 Query: 117 KRDEYEEAYCKFSAYRYIVHTVSSDND*VL 28 KRD Y+ + K + YI V +D D V+ Sbjct: 38 KRDHYKPEFLKLNPQHYIPTLVDADGDVVV 67 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 5.3 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +3 Query: 270 ISLSKLSCYVICDGQRYIA 326 +SL++L C + C+G ++A Sbjct: 949 VSLNELPCNIKCEGANFLA 967 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 414,539 Number of Sequences: 2352 Number of extensions: 6319 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53824896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -