BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0894 (696 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 25 2.3 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 24 5.3 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 24 5.3 AM182453-1|CAJ65691.1| 168|Anopheles gambiae globin 1 protein. 24 5.3 AM182452-1|CAJ65690.1| 168|Anopheles gambiae globin 1 protein. 24 5.3 AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. 23 7.0 AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CY... 23 9.2 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 25.0 bits (52), Expect = 2.3 Identities = 10/30 (33%), Positives = 21/30 (70%) Frame = +2 Query: 449 ETSETKSVEDFNVAANAMVETEAITPEPTY 538 E++ T+ + +F+ A++MVET + +PT+ Sbjct: 2099 ESTMTEPMFEFSYNADSMVETMNVRTDPTH 2128 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.8 bits (49), Expect = 5.3 Identities = 11/38 (28%), Positives = 23/38 (60%), Gaps = 4/38 (10%) Frame = +2 Query: 272 VDILQALRSSEVGDE----KDEDFRYQVEEYKKVESDI 373 VD ++A ++ D+ ++E RY+ E Y+K+ S++ Sbjct: 1007 VDKIKAQIEQDIRDQPNAPEEEKIRYRNESYEKINSEL 1044 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.8 bits (49), Expect = 5.3 Identities = 11/38 (28%), Positives = 23/38 (60%), Gaps = 4/38 (10%) Frame = +2 Query: 272 VDILQALRSSEVGDE----KDEDFRYQVEEYKKVESDI 373 VD ++A ++ D+ ++E RY+ E Y+K+ S++ Sbjct: 1008 VDKIKAQIEQDIRDQPNAPEEEKIRYRNESYEKINSEL 1045 >AM182453-1|CAJ65691.1| 168|Anopheles gambiae globin 1 protein. Length = 168 Score = 23.8 bits (49), Expect = 5.3 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +2 Query: 425 QINNPNPEETSETKSVEDFNVAANAMVETEAIT 523 Q N P+ET TKS + +AA ++V+ + +T Sbjct: 15 QTNYHTPDETGLTKSQKVALIAAWSIVKKDLVT 47 >AM182452-1|CAJ65690.1| 168|Anopheles gambiae globin 1 protein. Length = 168 Score = 23.8 bits (49), Expect = 5.3 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +2 Query: 425 QINNPNPEETSETKSVEDFNVAANAMVETEAIT 523 Q N P+ET TKS + +AA ++V+ + +T Sbjct: 15 QTNYHTPDETGLTKSQKVALIAAWSIVKKDLVT 47 >AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. Length = 525 Score = 23.4 bits (48), Expect = 7.0 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +2 Query: 629 IRLYGQEFTLSENADSPVPSP 691 I LYG+ FTL+ A++ + +P Sbjct: 276 IPLYGRNFTLASAANTQIGAP 296 >AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CYP6S2 protein. Length = 504 Score = 23.0 bits (47), Expect = 9.2 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 69 PNSELFPSGISGICSNI 19 PN E+ P G+ I SN+ Sbjct: 383 PNGEVIPEGVGVIISNL 399 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 552,725 Number of Sequences: 2352 Number of extensions: 9379 Number of successful extensions: 22 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -